RPSBLAST alignment for GI: 255764513 and conserved domain: cd00807

>gnl|CDD|185676 cd00807, GlnRS_core, catalytic core domain of glutaminyl-tRNA synthetase. Glutaminyl-tRNA synthetase (GlnRS) cataytic core domain. These enzymes attach Gln to the appropriate tRNA. Like other class I tRNA synthetases, they aminoacylate the 2'-OH of the nucleotide at the 3' end of the tRNA. The core domain is based on the Rossman fold and is responsible for the ATP-dependent formation of the enzyme bound aminoacyl-adenylate. GlnRS contains the characteristic class I HIGH and KMSKS motifs, which are involved in ATP binding. These enzymes function as monomers. Archaea and most bacteria lack GlnRS. In these organisms, the "non-discriminating" form of GluRS aminoacylates both tRNA(Glu) and tRNA(Gln) with Glu, which is converted to Gln when appropriate by a transamidation enzyme. Length = 238
 Score = 63.8 bits (156), Expect = 1e-10
 Identities = 24/68 (35%), Positives = 37/68 (54%)

Query: 6  KVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSL 65
          KV  R  P P G  HIG A   L N+  AK+ GG+  LR +DT+ ++   E  +++ + +
Sbjct: 1  KVVTRFPPEPNGYLHIGHAKAILLNFGYAKKYGGRCNLRFDDTNPEKEEEEYVDSIKEDV 60

Query: 66 KWCGLNWD 73
          KW G+   
Sbjct: 61 KWLGIKPY 68