>cd03217 ABC_FeS_Assembly ABC-type transport system involved in Fe-S cluster assembly, ATPase component. Biosynthesis of iron-sulfur clusters (Fe-S) depends on multiprotein systems. The SUF system of E. coli and Erwinia chrysanthemi is important for Fe-S biogenesis under stressful conditions. The SUF system is made of six proteins: SufC is an atypical cytoplasmic ABC-ATPase, which forms a complex with SufB and SufD; SufA plays the role of a scaffold protein for assembly of iron-sulfur clusters and delivery to target proteins; SufS is a cysteine desulfurase which mobilizes the sulfur atom from cysteine and provides it to the cluster; SufE has no associated function yet.

Probab=98.39 E-value=2.2e-06 Score=60.99 Aligned_cols=73 Identities=25% Similarity=0.342 Sum_probs=60.4 Q ss_pred HCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHH-HCCCEEEEECHHHHHHH--CCCEEEEEE Q ss_conf 062157999999999843668997699803446888799999999999973-05939998083798650--176179999 Q gi|255764514|r 428 ASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLS-KKIQLLAVTHAPQVAAR--ADRHFLVYK 504 (554) Q Consensus 428 aSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls-~~~Qvi~ITH~pqvAa~--a~~h~~v~K 504 (554) T Consensus 105 LSGGekqrv~iaral~~----~P~lllLDEPtsgLD~~~~~~i~~~i~~l~~~g~tiiiitH~~~~~~~~~~Drv~vl~~ 180 (200) T cd03217 105 FSGGEKKRNEILQLLLL----EPDLAILDEPDSGLDIDALRLVAEVINKLREEGKSVLIITHYQRLLDYIKPDRVHVLYD 180 (200) T ss_pred CCHHHHHHHHHHHHHHH----CCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCEEEEEEECHHHHHHHCCCEEEEEEC T ss_conf 79999999999999960----99999996962269999999999999999857999999996368776646999999879

HHsearch alignment for GI: 255764514 and conserved domain: cd03217