>cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids. RLI's are not transport proteins, and thus cluster with a group of soluble proteins that lack the transmembrane components commonly found in other members of the family. Structurally, RLI's have an N-terminal Fe-S domain and two nucleotide-binding domains, which are arranged to form two composite active sites in their interface cleft. RLI is one of the most conserved enzymes between archaea and eukaryotes with a sequence identity more than 48%. The high degree of evolutionary conservation suggests that RLI performs a central role in archaeal and eukaryotic physiology.

Probab=98.13 E-value=2e-05 Score=54.75 Aligned_cols=73 Identities=25% Similarity=0.280 Sum_probs=61.5 Q ss_pred HCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCC--EEEEECHHHHHH-HCCCEEEEEE Q ss_conf 0621579999999998436689976998034468887999999999999730593--999808379865-0176179999 Q gi|255764514|r 428 ASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSKKIQ--LLAVTHAPQVAA-RADRHFLVYK 504 (554) Q Consensus 428 aSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~~~Q--vi~ITH~pqvAa-~a~~h~~v~K 504 (554) T Consensus 72 LSGGqrQRv~iAral~----~~p~lllLDEPts~LD~~~r~~i~~~ik~l~~~~~~Tvl~vsHdl~~a~~~aDrI~vl~g 147 (177) T cd03222 72 LSGGELQRVAIAAALL----RNATFYLFDEPSAYLDIEQRLNAARAIRRLSEEGKKTALVVEHDLAVLDYLSDRIHVFEG 147 (177) T ss_pred CCHHHHHHHHHHHHHH----CCCCEEEECCCCCCCCHHHHHHHHHHHHHHHHHCCCEEEEECCCHHHHHHHCCEEEEEEC T ss_conf 7989999999999982----399999974886538999999999999999996597799985889999986999999938

HHsearch alignment for GI: 255764514 and conserved domain: cd03222