>cd03237 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 of RNase L inhibitor. The ABC ATPase, RNase L inhibitor (RLI), is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids. RLI's are not transport proteins and thus cluster with a group of soluble proteins that lack the transmembrane components commonly found in other members of the family. Structurally, RLI's have an N-terminal Fe-S domain and two nucleotide-binding domains which are arranged to form two composite active sites in their interface cleft. RLI is one of the most conserved enzymes between archaea and eukaryotes with a sequence identity of more than 48%. The high degree of evolutionary conservation suggests that RLI performs a central role in archaeal and eukaryotic physiology.

Probab=98.20 E-value=1.4e-05 Score=55.80 Aligned_cols=72 Identities=17% Similarity=0.222 Sum_probs=59.8 Q ss_pred HCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCC--CEEEEECHHHHHHHCCCEEEEE Q ss_conf 062157999999999843668997699803446888799999999999973059--3999808379865017617999 Q gi|255764514|r 428 ASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSKKI--QLLAVTHAPQVAARADRHFLVY 503 (554) Q Consensus 428 aSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~~~--Qvi~ITH~pqvAa~a~~h~~v~ 503 (554) T Consensus 116 LSGGqkQRv~iA~aL~----~~p~ilLLDEPts~LD~~~~~~i~~~i~~l~~~~~~Tvi~VtHDl~~a~~~aDrIivl 189 (246) T cd03237 116 LSGGELQRVAIAACLS----KDADIYLLDEPSAYLDVEQRLMASKVIRRFAENNEKTAFVVEHDIIMIDYLADRLIVF 189 (246) T ss_pred CCHHHHHHHHHHHHHH----CCCCEEEECCCCCCCCHHHHHHHHHHHHHHHHHCCCEEEEECCCHHHHHHHCCEEEEE T ss_conf 8985999999999984----1999999848987689999999999999999867989999837899999869999998

HHsearch alignment for GI: 255764514 and conserved domain: cd03237