>cd03240 ABC_Rad50 The catalytic domains of Rad50 are similar to the ATP-binding cassette of ABC transporters, but are not associated with membrane-spanning domains. The conserved ATP-binding motifs common to Rad50 and the ABC transporter family include the Walker A and Walker B motifs, the Q loop, a histidine residue in the switch region, a D-loop, and a conserved LSGG sequence. This conserved sequence, LSGG, is the most specific and characteristic motif of this family and is thus known as the ABC signature sequence.

Probab=99.58 E-value=1.8e-13 Score=107.76 Aligned_cols=75 Identities=24% Similarity=0.338 Sum_probs=60.9 Q ss_pred HCCHHHH------HHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHH-HHHHHHHHHHHCC--CEEEEECHHHHHHHCCC Q ss_conf 0621579------9999999984366899769980344688879999-9999999973059--39998083798650176 Q gi|255764514|r 428 ASGGELS------RFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVAD-AIGYRLKQLSKKI--QLLAVTHAPQVAARADR 498 (554) Q Consensus 428 aSGGE~S------r~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~-~v~~~l~~ls~~~--Qvi~ITH~pqvAa~a~~ 498 (554) T Consensus 116 LSgGqkq~~~l~~RlalAraL~----~~p~lllLDEPTs~LD~~~~~~~l~~ll~~~~~~~~~tiIivtHd~e~~~~aD~ 191 (204) T cd03240 116 CSGGEKVLASLIIRLALAETFG----SNCGILALDEPTTNLDEENIEESLAEIIEERKSQKNFQLIVITHDEELVDAADH 191 (204) T ss_pred CCHHHCCCCHHHHHHHHHHHHH----CCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHCCCCEEEEEECCHHHHHHCCE T ss_conf 7864307230756999999984----599989981876669978999999999999985699899999449899984995 Q ss_pred EEEEEEEE Q ss_conf 17999962 Q gi|255764514|r 499 HFLVYKTN 506 (554) Q Consensus 499 h~~v~K~~ 506 (554) T Consensus 192 vv~i~kdG 199 (204) T cd03240 192 IYRVEKDG 199 (204) T ss_pred EEEEECCC T ss_conf 99995898

HHsearch alignment for GI: 255764514 and conserved domain: cd03240