>cd03263 ABC_subfamily_A The ABCA subfamily mediates the transport of a variety of lipid compounds. Mutations of members of ABCA subfamily are associated with human genetic diseases, such as, familial high-density lipoprotein (HDL) deficiency, neonatal surfactant deficiency, degenerative retinopathies, and congenital keratinization disorders. The ABCA1 protein is involved in disorders of cholesterol transport and high-density lipoprotein (HDL) biosynthesis. The ABCA4 (ABCR) protein transports vitamin A derivatives in the outer segments of photoreceptor cells, and therefore, performs a crucial step in the visual cycle. The ABCA genes are not present in yeast. However, evolutionary studies of ABCA genes indicate that they arose as transporters that subsequently duplicated and that certain sets of ABCA genes were lost in different eukaryotic lineages.

Probab=98.24 E-value=1.1e-05 Score=56.47 Aligned_cols=73 Identities=29% Similarity=0.357 Sum_probs=61.9 Q ss_pred HHCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCEEEEECHHHHH-HHCCCEEEEE Q ss_conf 4062157999999999843668997699803446888799999999999973059399980837986-5017617999 Q gi|255764514|r 427 LASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSKKIQLLAVTHAPQVA-ARADRHFLVY 503 (554) Q Consensus 427 iaSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~~~Qvi~ITH~pqvA-a~a~~h~~v~ 503 (554) T Consensus 133 ~LSgG~kqrv~ia~al~----~~P~lliLDEPt~gLD~~~~~~i~~~l~~~~~~~tii~~tH~l~e~~~l~dri~vl~ 206 (220) T cd03263 133 TLSGGMKRKLSLAIALI----GGPSVLLLDEPTSGLDPASRRAIWDLILEVRKGRSIILTTHSMDEAEALCDRIAIMS 206 (220) T ss_pred HCCHHHHHHHHHHHHHH----CCCCEEEEECCCCCCCHHHHHHHHHHHHHHHCCCEEEEECCCHHHHHHHCCEEEEEE T ss_conf 78999999999999995----699999995887688999999999999998489989999687899999699999998

HHsearch alignment for GI: 255764514 and conserved domain: cd03263