>cd03269 ABC_putative_ATPase This subfamily is involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity. In eubacteria and archaea, the typical organization consists of one ABC and one or two IMs. Eukaryote systems of the ABCA subfamily display ABC domains strongly similar to this family. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region in addition to the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.

Probab=97.78 E-value=4.4e-05 Score=52.42 Aligned_cols=73 Identities=18% Similarity=0.283 Sum_probs=59.1 Q ss_pred HHCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHC-CCEEEEECHHHHHHH-CCCEEEEE Q ss_conf 406215799999999984366899769980344688879999999999997305-939998083798650-17617999 Q gi|255764514|r 427 LASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSKK-IQLLAVTHAPQVAAR-ADRHFLVY 503 (554) Q Consensus 427 iaSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~~-~Qvi~ITH~pqvAa~-a~~h~~v~ 503 (554) T Consensus 128 ~LSgG~kqrv~la~al~----~~p~lllLDEPt~gLDp~~~~~i~~~i~~~~~~g~til~ssH~l~e~~~~~d~i~vl~ 202 (210) T cd03269 128 ELSKGNQQKVQFIAAVI----HDPELLILDEPFSGLDPVNVELLKDVIRELARAGKTVILSTHQMELVEELCDRVLLLN 202 (210) T ss_pred HCCHHHHHHHHHHHHHH----CCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCEEEEECCCHHHHHHHCCEEEEEE T ss_conf 78998999999999995----7998999928866799999999999999999689899998884899999699999998

HHsearch alignment for GI: 255764514 and conserved domain: cd03269