Query gi|255764514|ref|YP_003065586.2| DNA repair protein RecN [Candidatus Liberibacter asiaticus str. psy62] Match_columns 554 No_of_seqs 509 out of 4992 Neff 9.3 Searched_HMMs 39220 Date Mon May 30 06:32:27 2011 Command /home/congqian_1/programs/hhpred/hhsearch -i 255764514.hhm -d /home/congqian_1/database/cdd/Cdd.hhm No Hit Prob E-value P-value Score SS Cols Query HMM Template HMM 1 PRK10869 recombination and rep 100.0 0 0 1079.0 57.1 549 1-553 2-553 (553) 2 COG0497 RecN ATPase involved i 100.0 0 0 1052.0 55.9 548 1-553 2-554 (557) 3 TIGR00634 recN DNA repair prot 100.0 0 0 1010.4 44.4 549 1-553 2-605 (605) 4 cd03241 ABC_RecN RecN ATPase i 100.0 0 0 675.5 32.1 276 1-536 1-276 (276) 5 TIGR02168 SMC_prok_B chromosom 100.0 0 0 419.3 42.0 130 375-511 1052-1184(1191) 6 TIGR02169 SMC_prok_A chromosom 100.0 0 0 409.4 38.2 174 1-174 2-211 (1202) 7 pfam02463 SMC_N RecF/RecN/SMC 100.0 0 0 391.3 41.8 118 385-508 1042-1159(1162) 8 COG1196 Smc Chromosome segrega 100.0 0 0 373.6 45.5 120 385-511 1030-1149(1163) 9 PRK02224 chromosome segregatio 100.0 1.2E-43 0 306.6 43.1 97 409-507 765-871 (880) 10 PRK01156 chromosome segregatio 100.0 2.9E-39 7.3E-44 277.8 42.0 90 416-506 791-886 (895) 11 cd03275 ABC_SMC1_euk Eukaryoti 100.0 2.2E-42 0 298.4 21.8 217 1-510 1-239 (247) 12 PRK03918 chromosome segregatio 100.0 3.1E-37 7.9E-42 264.4 43.2 98 415-521 781-881 (882) 13 KOG0996 consensus 100.0 8.1E-38 2.1E-42 268.2 31.5 118 387-512 1161-1278(1293) 14 cd03272 ABC_SMC3_euk Eukaryoti 100.0 4.7E-40 1.3E-44 283.0 19.1 216 1-505 1-236 (243) 15 KOG0933 consensus 100.0 1.2E-34 3E-39 247.4 34.5 146 1-151 3-171 (1174) 16 KOG0964 consensus 100.0 4.4E-34 1.1E-38 243.6 33.2 111 409-526 1079-1189(1200) 17 KOG0018 consensus 100.0 1.1E-32 2.8E-37 234.4 34.1 119 379-505 1009-1127(1141) 18 cd03274 ABC_SMC4_euk Eukaryoti 100.0 2.9E-35 7.4E-40 251.4 15.8 91 417-508 118-208 (212) 19 cd03273 ABC_SMC2_euk Eukaryoti 100.0 1.9E-34 4.8E-39 246.1 16.8 221 1-505 3-244 (251) 20 COG0419 SbcC ATPase involved i 100.0 6.5E-29 1.7E-33 209.6 41.4 85 421-506 810-899 (908) 21 KOG0979 consensus 100.0 1.1E-28 2.7E-33 208.1 37.0 106 1-122 22-135 (1072) 22 KOG0250 consensus 100.0 3.4E-29 8.6E-34 211.4 26.7 138 1-147 42-193 (1074) 23 cd03239 ABC_SMC_head The struc 100.0 2.9E-29 7.4E-34 211.9 11.0 79 428-506 95-174 (178) 24 PRK00064 recF recombination pr 99.9 1.6E-21 4E-26 160.9 30.9 151 1-170 3-159 (355) 25 PRK10246 exonuclease subunit S 99.9 3.3E-21 8.4E-26 158.8 28.0 99 410-509 932-1036(1047) 26 cd03242 ABC_RecF RecF is a rec 99.9 2.5E-21 6.3E-26 159.6 22.7 152 1-171 1-158 (270) 27 TIGR03185 DNA_S_dndD DNA sulfu 99.9 5E-18 1.3E-22 137.8 37.7 99 1-111 3-128 (650) 28 cd03278 ABC_SMC_barmotin Barmo 99.9 2.1E-20 5.3E-25 153.5 17.9 78 427-504 113-190 (197) 29 cd03276 ABC_SMC6_euk Eukaryoti 99.9 5.6E-21 1.4E-25 157.3 14.8 72 1-72 1-80 (198) 30 COG1195 RecF Recombinational D 99.8 1.5E-17 3.8E-22 134.7 26.0 130 1-149 3-140 (363) 31 TIGR00618 sbcc exonuclease Sbc 99.7 8.3E-16 2.1E-20 123.1 18.4 100 405-507 951-1058(1063) 32 cd03227 ABC_Class2 ABC-type Cl 99.7 3.4E-15 8.6E-20 119.1 12.9 79 428-506 78-157 (162) 33 cd03277 ABC_SMC5_euk Eukaryoti 99.6 6.5E-16 1.6E-20 123.9 8.2 70 1-70 3-80 (213) 34 TIGR00611 recf DNA replication 99.6 3.5E-15 8.8E-20 119.1 10.6 153 1-171 3-179 (399) 35 cd03240 ABC_Rad50 The catalyti 99.6 1.8E-13 4.6E-18 107.8 15.7 75 428-506 116-199 (204) 36 cd00267 ABC_ATPase ABC (ATP-bi 99.6 4.5E-13 1.2E-17 105.1 17.6 73 428-504 81-154 (157) 37 KOG0250 consensus 99.5 1.2E-10 3.1E-15 89.1 24.4 81 421-504 984-1066(1074) 38 cd03279 ABC_sbcCD SbcCD and ot 99.5 8.8E-14 2.3E-18 109.8 8.2 71 1-71 3-86 (213) 39 COG3950 Predicted ATP-binding 99.4 1.8E-11 4.5E-16 94.6 16.6 47 1-47 3-50 (440) 40 PRK10246 exonuclease subunit S 99.4 6.8E-08 1.7E-12 71.0 33.1 73 2-74 4-92 (1047) 41 KOG0962 consensus 99.3 8.9E-09 2.3E-13 76.8 21.0 70 2-71 5-88 (1294) 42 COG4717 Uncharacterized conser 99.2 3.9E-08 1E-12 72.5 22.1 80 411-493 887-970 (984) 43 pfam12128 DUF3584 Protein of u 99.2 1.9E-08 4.9E-13 74.6 19.5 33 15-48 12-44 (1192) 44 TIGR00606 rad50 rad50; InterPr 99.1 1.6E-07 4E-12 68.6 22.7 67 2-68 4-86 (1328) 45 COG3593 Predicted ATP-dependen 99.0 1.4E-09 3.5E-14 82.2 5.9 49 1-49 3-51 (581) 46 PRK04863 mukB cell division pr 98.9 6.9E-06 1.8E-10 57.8 27.7 45 1-45 7-51 (1486) 47 COG1106 Predicted ATPases [Gen 98.8 2.1E-09 5.5E-14 80.9 2.9 47 1-47 2-48 (371) 48 COG5293 Predicted ATPase [Gene 98.8 2.2E-05 5.6E-10 54.4 27.9 38 16-53 20-68 (591) 49 cd03223 ABCD_peroxisomal_ALDP 98.7 5.6E-08 1.4E-12 71.5 8.3 71 428-504 92-162 (166) 50 TIGR00618 sbcc exonuclease Sbc 98.7 1.9E-05 4.9E-10 54.8 21.1 77 2-78 4-97 (1063) 51 PRK10535 macrolide transporter 98.7 8.2E-08 2.1E-12 70.4 8.9 34 10-43 22-56 (648) 52 cd03245 ABCC_bacteriocin_expor 98.7 1E-07 2.7E-12 69.8 9.4 73 428-504 141-213 (220) 53 COG4637 Predicted ATPase [Gene 98.7 3.3E-09 8.4E-14 79.6 1.6 99 401-504 247-345 (373) 54 cd03228 ABCC_MRP_Like The MRP 98.7 1E-07 2.5E-12 69.9 9.0 72 428-503 97-168 (171) 55 cd03254 ABCC_Glucan_exporter_l 98.7 1.6E-07 4.2E-12 68.5 9.4 73 428-504 140-212 (229) 56 cd03238 ABC_UvrA The excision 98.7 2.3E-07 5.8E-12 67.5 9.7 76 428-506 88-165 (176) 57 PRK10789 putative multidrug tr 98.7 2.6E-07 6.6E-12 67.2 9.4 73 428-504 452-524 (569) 58 cd03251 ABCC_MsbA MsbA is an e 98.6 4E-07 1E-11 65.9 9.9 73 428-504 139-211 (234) 59 cd03253 ABCC_ATM1_transporter 98.6 3.7E-07 9.3E-12 66.2 9.6 73 428-504 138-210 (236) 60 PRK11176 lipid transporter ATP 98.6 4.1E-07 1E-11 65.9 9.5 74 427-504 479-552 (581) 61 COG4988 CydD ABC-type transpor 98.6 3.3E-07 8.5E-12 66.4 9.0 74 427-504 456-529 (559) 62 PRK13657 cyclic beta-1,2-gluca 98.6 4.9E-07 1.2E-11 65.4 9.7 73 428-504 472-544 (585) 63 cd03249 ABC_MTABC3_MDL1_MDL2 M 98.6 4.7E-07 1.2E-11 65.4 9.6 73 428-504 140-212 (238) 64 PRK10584 putative ABC transpor 98.6 4.5E-07 1.1E-11 65.6 9.2 72 428-503 147-220 (228) 65 cd03248 ABCC_TAP TAP, the Tran 98.6 4.3E-07 1.1E-11 65.7 8.9 72 428-503 151-222 (226) 66 PRK11160 cysteine/glutathione 98.6 7.2E-07 1.8E-11 64.2 9.6 80 417-504 470-549 (575) 67 cd03252 ABCC_Hemolysin The ABC 98.6 6.8E-07 1.7E-11 64.4 9.3 72 428-503 139-210 (237) 68 cd03246 ABCC_Protease_Secretio 98.6 5.5E-07 1.4E-11 65.0 8.8 72 428-503 97-169 (173) 69 PRK10247 putative ABC transpor 98.5 7.8E-07 2E-11 64.0 9.1 73 428-504 138-212 (225) 70 PRK11174 cysteine/glutathione 98.5 9.4E-07 2.4E-11 63.5 9.4 74 427-504 485-558 (588) 71 cd03247 ABCC_cytochrome_bd The 98.5 6.3E-07 1.6E-11 64.6 8.5 72 428-503 99-170 (178) 72 cd03369 ABCC_NFT1 Domain 2 of 98.5 7.4E-07 1.9E-11 64.1 8.8 72 428-503 126-197 (207) 73 PRK10790 putative multidrug tr 98.5 9.8E-07 2.5E-11 63.3 9.2 73 428-504 477-549 (593) 74 cd03255 ABC_MJ0796_Lo1CDE_FtsE 98.5 9.1E-07 2.3E-11 63.6 8.7 73 428-504 141-215 (218) 75 COG1136 SalX ABC-type antimicr 98.5 1.1E-06 2.8E-11 63.1 8.9 73 428-504 143-217 (226) 76 TIGR03608 L_ocin_972_ABC putat 98.5 1.1E-06 2.8E-11 63.1 8.7 69 428-500 135-204 (206) 77 cd03271 ABC_UvrA_II The excisi 98.5 1.4E-06 3.6E-11 62.3 8.9 74 428-502 170-244 (261) 78 PRK11629 lolD lipoprotein tran 98.5 1.5E-06 3.9E-11 62.1 9.1 71 428-502 146-218 (233) 79 PRK13547 hmuV hemin importer A 98.5 2.2E-06 5.5E-11 61.1 9.6 75 428-502 146-229 (273) 80 cd03244 ABCC_MRP_domain2 Domai 98.5 1.6E-06 4E-11 62.0 8.9 72 428-503 140-211 (221) 81 PRK13640 cbiO cobalt transport 98.4 1.4E-06 3.5E-11 62.3 8.5 73 428-504 145-219 (283) 82 TIGR03375 type_I_sec_LssB type 98.4 2.8E-06 7.1E-11 60.4 9.6 74 427-504 601-674 (694) 83 cd03233 ABC_PDR_domain1 The pl 98.4 1.2E-06 3E-11 62.8 7.6 73 428-504 119-195 (202) 84 cd03270 ABC_UvrA_I The excisio 98.4 1.8E-06 4.6E-11 61.6 8.5 73 428-503 138-212 (226) 85 cd03288 ABCC_SUR2 The SUR doma 98.4 2.2E-06 5.7E-11 61.0 8.9 73 428-504 157-229 (257) 86 PRK13540 cytochrome c biogenes 98.4 1.7E-06 4.4E-11 61.7 8.0 68 428-499 128-196 (200) 87 cd03250 ABCC_MRP_domain1 Domai 98.4 2.2E-06 5.7E-11 61.0 8.6 72 428-503 128-201 (204) 88 cd03289 ABCC_CFTR2 The CFTR su 98.4 2.6E-06 6.7E-11 60.5 8.8 73 428-504 139-211 (275) 89 cd03225 ABC_cobalt_CbiO_domain 98.4 3.3E-06 8.5E-11 59.9 9.3 72 428-503 135-208 (211) 90 cd03260 ABC_PstB_phosphate_tra 98.4 3.4E-06 8.6E-11 59.8 9.3 73 428-504 142-215 (227) 91 cd03262 ABC_HisP_GlnQ_permease 98.4 3.1E-06 7.9E-11 60.1 9.1 72 428-503 136-209 (213) 92 cd03217 ABC_FeS_Assembly ABC-t 98.4 2.2E-06 5.7E-11 61.0 8.4 73 428-504 105-180 (200) 93 TIGR02857 CydD ABC transporter 98.4 1.4E-06 3.6E-11 62.3 7.3 73 427-500 495-568 (570) 94 PRK13539 cytochrome c biogenes 98.4 1.1E-06 2.8E-11 63.0 6.6 66 428-497 127-193 (206) 95 PRK13648 cbiO cobalt transport 98.4 2.7E-06 6.8E-11 60.5 8.5 73 428-504 143-217 (269) 96 cd03213 ABCG_EPDR ABCG transpo 98.4 3E-06 7.7E-11 60.1 8.8 73 428-504 112-187 (194) 97 PRK13642 cbiO cobalt transport 98.4 3.5E-06 8.9E-11 59.7 8.9 73 428-504 141-215 (277) 98 COG1132 MdlB ABC-type multidru 98.4 2.8E-06 7.1E-11 60.4 8.3 73 428-504 466-538 (567) 99 TIGR01978 sufC FeS assembly AT 98.4 2.7E-06 7E-11 60.4 8.1 61 429-494 149-213 (248) 100 PRK11831 putative ABC transpor 98.4 4.5E-06 1.2E-10 59.0 9.2 73 428-504 145-220 (269) 101 COG1121 ZnuC ABC-type Mn/Zn tr 98.3 3.8E-06 9.7E-11 59.5 8.6 81 423-508 136-218 (254) 102 cd03235 ABC_Metallic_Cations A 98.3 5.3E-06 1.3E-10 58.5 9.3 71 428-502 133-205 (213) 103 PRK09984 phosphonate/organopho 98.3 5.1E-06 1.3E-10 58.6 9.1 100 427-535 152-253 (262) 104 cd03234 ABCG_White The White s 98.3 4.4E-06 1.1E-10 59.1 8.8 73 428-504 144-219 (226) 105 PRK13649 cbiO cobalt transport 98.3 4.9E-06 1.3E-10 58.7 9.0 73 428-504 146-220 (280) 106 cd03257 ABC_NikE_OppD_transpor 98.3 3.2E-06 8.1E-11 60.0 8.0 73 428-504 146-221 (228) 107 PRK09580 sufC cysteine desulfu 98.3 5.3E-06 1.4E-10 58.5 8.9 73 428-504 146-220 (248) 108 PRK13538 cytochrome c biogenes 98.3 5.1E-06 1.3E-10 58.6 8.8 71 428-503 130-201 (204) 109 TIGR02315 ABC_phnC phosphonate 98.3 1E-06 2.5E-11 63.3 5.1 41 10-50 16-58 (253) 110 PRK10418 nikD nickel transport 98.3 6.2E-06 1.6E-10 58.0 9.2 74 428-505 141-216 (254) 111 cd03292 ABC_FtsE_transporter F 98.3 5.6E-06 1.4E-10 58.3 8.9 72 428-503 137-210 (214) 112 PRK13643 cbiO cobalt transport 98.3 5.8E-06 1.5E-10 58.3 8.9 73 428-504 145-219 (288) 113 COG4637 Predicted ATPase [Gene 98.3 1.1E-05 2.7E-10 56.5 10.1 44 1-45 3-46 (373) 114 cd03291 ABCC_CFTR1 The CFTR su 98.3 6.4E-06 1.6E-10 58.0 8.8 101 428-542 160-264 (282) 115 TIGR02680 TIGR02680 conserved 98.3 0.00041 1E-08 46.1 18.8 44 3-46 6-50 (1416) 116 cd03226 ABC_cobalt_CbiO_domain 98.3 6.9E-06 1.8E-10 57.7 8.9 72 428-503 127-200 (205) 117 PRK10744 phosphate transporter 98.3 6.7E-06 1.7E-10 57.9 8.8 73 428-504 154-226 (257) 118 cd03221 ABCF_EF-3 ABCF_EF-3 E 98.3 6.9E-06 1.8E-10 57.8 8.7 69 428-502 71-140 (144) 119 PRK13633 cobalt transporter AT 98.3 7.6E-06 1.9E-10 57.5 8.9 73 428-504 146-220 (281) 120 cd03231 ABC_CcmA_heme_exporter 98.3 9E-06 2.3E-10 57.0 9.1 72 427-502 125-198 (201) 121 PRK13632 cbiO cobalt transport 98.3 7.9E-06 2E-10 57.4 8.8 73 428-504 144-218 (273) 122 PRK10575 iron-hydroxamate tran 98.3 1.1E-05 2.9E-10 56.4 9.5 73 428-504 148-223 (265) 123 cd03263 ABC_subfamily_A The AB 98.2 1.1E-05 2.8E-10 56.5 9.2 73 427-503 133-206 (220) 124 PRK13635 cbiO cobalt transport 98.2 8.6E-06 2.2E-10 57.1 8.6 73 428-504 141-215 (279) 125 cd03215 ABC_Carb_Monos_II This 98.2 1.1E-05 2.9E-10 56.4 9.1 72 428-503 105-178 (182) 126 COG3910 Predicted ATPase [Gene 98.2 4.6E-07 1.2E-11 65.5 2.0 40 8-47 22-63 (233) 127 PRK10771 thiQ thiamine transpo 98.2 1E-05 2.6E-10 56.6 8.8 73 428-504 130-205 (233) 128 CHL00131 ycf16 sulfate ABC tra 98.2 1.2E-05 3E-10 56.2 9.1 73 428-504 151-225 (252) 129 PRK13646 cbiO cobalt transport 98.2 1E-05 2.6E-10 56.7 8.7 73 428-504 146-221 (286) 130 PRK11231 fecE iron-dicitrate t 98.2 3E-06 7.6E-11 60.2 6.0 73 428-504 139-213 (255) 131 PRK13544 consensus 98.2 1.3E-05 3.3E-10 56.0 9.2 76 428-507 127-203 (208) 132 PRK10908 cell division protein 98.2 1.6E-05 4E-10 55.4 9.6 74 428-505 138-212 (222) 133 TIGR00955 3a01204 Pigment prec 98.2 3E-06 7.7E-11 60.1 5.9 24 19-42 55-79 (671) 134 PRK10938 putative molybdenum t 98.2 1.3E-05 3.4E-10 55.9 9.1 79 422-505 397-478 (490) 135 PRK13652 cbiO cobalt transport 98.2 1.1E-05 2.8E-10 56.4 8.6 73 428-504 138-213 (277) 136 PRK13644 cbiO cobalt transport 98.2 1.3E-05 3.3E-10 56.0 8.9 73 428-504 137-210 (274) 137 cd03237 ABC_RNaseL_inhibitor_d 98.2 1.4E-05 3.5E-10 55.8 8.9 72 428-503 116-189 (246) 138 PRK13641 cbiO cobalt transport 98.2 1.4E-05 3.6E-10 55.7 9.0 73 428-504 146-220 (286) 139 PRK10522 multidrug transporter 98.2 1.4E-05 3.5E-10 55.8 8.9 73 428-504 450-524 (547) 140 cd03256 ABC_PhnC_transporter A 98.2 1.7E-05 4.4E-10 55.1 9.4 72 428-503 145-219 (241) 141 COG0396 sufC Cysteine desulfur 98.2 1.4E-05 3.5E-10 55.8 8.9 66 428-497 145-211 (251) 142 PRK13409 putative ATPase RIL; 98.2 7.2E-06 1.8E-10 57.6 7.3 77 423-504 450-528 (590) 143 PRK13645 cbiO cobalt transport 98.2 1.8E-05 4.6E-10 55.0 9.1 73 428-504 151-226 (289) 144 PRK13634 cbiO cobalt transport 98.2 1.5E-05 3.9E-10 55.5 8.7 73 428-504 133-208 (276) 145 PRK10253 iron-enterobactin tra 98.2 2E-05 5.1E-10 54.7 9.3 73 428-504 144-219 (265) 146 PRK13548 hmuV hemin importer A 98.2 2.3E-05 5.9E-10 54.3 9.6 77 428-504 135-215 (257) 147 PRK11231 fecE iron-dicitrate t 98.2 2.3E-05 5.7E-10 54.4 9.5 43 3-45 2-52 (255) 148 COG1131 CcmA ABC-type multidru 98.2 2.1E-05 5.3E-10 54.6 9.2 36 8-43 17-53 (293) 149 PRK13647 cbiO cobalt transport 98.2 1.9E-05 4.8E-10 54.9 9.0 73 428-504 139-213 (273) 150 PRK13541 cytochrome c biogenes 98.2 5.1E-06 1.3E-10 58.6 6.1 67 427-497 123-190 (195) 151 PRK13650 cbiO cobalt transport 98.2 1.8E-05 4.5E-10 55.0 8.8 72 428-503 138-211 (276) 152 cd03232 ABC_PDR_domain2 The pl 98.2 1.5E-05 3.7E-10 55.6 8.3 73 428-504 109-184 (192) 153 PRK13549 xylose transporter AT 98.1 0.00013 3.2E-09 49.4 12.9 100 428-541 406-509 (513) 154 PRK10895 putative ABC transpor 98.1 2.3E-05 5.8E-10 54.4 9.1 73 428-504 138-212 (241) 155 COG1120 FepC ABC-type cobalami 98.1 5.1E-06 1.3E-10 58.6 5.7 75 427-505 138-214 (258) 156 PRK09493 glnQ glutamine ABC tr 98.1 2.1E-05 5.2E-10 54.6 8.8 73 428-504 137-211 (240) 157 PRK13541 cytochrome c biogenes 98.1 1.7E-05 4.4E-10 55.1 8.4 40 5-45 10-50 (195) 158 PRK11247 ssuB aliphatic sulfon 98.1 2.4E-05 6.2E-10 54.1 9.2 73 428-504 134-209 (257) 159 cd03267 ABC_NatA_like Similar 98.1 3E-05 7.6E-10 53.6 9.6 73 427-503 153-228 (236) 160 COG4913 Uncharacterized protei 98.1 0.00085 2.2E-08 44.0 26.2 45 1-45 17-61 (1104) 161 cd03214 ABC_Iron-Siderophores_ 98.1 2.4E-05 6.1E-10 54.2 9.0 73 428-504 98-172 (180) 162 cd03222 ABC_RNaseL_inhibitor T 98.1 2E-05 5E-10 54.8 8.5 73 428-504 72-147 (177) 163 PRK13638 cbiO cobalt transport 98.1 2.4E-05 6.2E-10 54.1 9.0 74 427-504 136-211 (271) 164 PRK09544 znuC high-affinity zi 98.1 2.8E-05 7.2E-10 53.7 9.3 71 428-502 121-194 (251) 165 PRK13639 cbiO cobalt transport 98.1 2.3E-05 5.8E-10 54.3 8.8 74 427-504 137-212 (275) 166 PRK11147 ABC transporter ATPas 98.1 1.2E-05 3E-10 56.2 7.2 77 421-504 435-512 (632) 167 PRK13544 consensus 98.1 6.5E-06 1.7E-10 57.9 5.8 41 4-44 9-50 (208) 168 COG4717 Uncharacterized conser 98.1 0.00095 2.4E-08 43.7 23.3 103 1-120 3-114 (984) 169 PRK09580 sufC cysteine desulfu 98.1 6.8E-06 1.7E-10 57.8 5.8 40 4-43 9-49 (248) 170 PRK13543 cytochrome c biogenes 98.1 3.8E-05 9.6E-10 52.9 9.5 73 428-504 138-211 (214) 171 COG4559 ABC-type hemin transpo 98.1 4.3E-06 1.1E-10 59.1 4.7 44 3-46 8-52 (259) 172 PRK13539 cytochrome c biogenes 98.1 6.7E-06 1.7E-10 57.8 5.6 40 4-43 10-50 (206) 173 TIGR00972 3a0107s01c2 phosphat 98.1 3.5E-06 8.8E-11 59.7 4.2 37 8-44 13-50 (248) 174 cd03298 ABC_ThiQ_thiamine_tran 98.1 3.1E-05 7.8E-10 53.5 9.0 72 428-503 129-203 (211) 175 PRK13651 cobalt transporter AT 98.1 3E-05 7.6E-10 53.6 8.9 73 428-504 162-236 (304) 176 COG4604 CeuD ABC-type enteroch 98.1 3.8E-06 9.8E-11 59.4 4.2 41 7-47 12-53 (252) 177 cd03264 ABC_drug_resistance_li 98.1 4.1E-05 1.1E-09 52.6 9.5 73 427-503 130-203 (211) 178 cd03224 ABC_TM1139_LivF_branch 98.1 3.2E-05 8.2E-10 53.4 8.9 72 428-503 133-206 (222) 179 cd03232 ABC_PDR_domain2 The pl 98.1 7E-06 1.8E-10 57.7 5.5 33 10-42 21-54 (192) 180 cd03258 ABC_MetN_methionine_tr 98.1 3E-05 7.7E-10 53.5 8.7 73 428-504 141-216 (233) 181 PRK13546 teichoic acids export 98.1 3.1E-05 7.9E-10 53.4 8.8 72 428-503 144-217 (264) 182 PRK09536 btuD corrinoid ABC tr 98.1 4.7E-05 1.2E-09 52.3 9.7 39 7-45 13-52 (409) 183 cd03290 ABCC_SUR1_N The SUR do 98.1 2.8E-05 7.3E-10 53.7 8.5 72 428-503 141-215 (218) 184 cd03259 ABC_Carb_Solutes_like 98.1 2.7E-05 6.9E-10 53.8 8.3 73 427-503 130-205 (213) 185 CHL00131 ycf16 sulfate ABC tra 98.1 7.8E-06 2E-10 57.4 5.5 38 5-42 15-53 (252) 186 PRK13636 cbiO cobalt transport 98.1 4.3E-05 1.1E-09 52.5 9.3 73 428-504 142-217 (285) 187 cd03216 ABC_Carb_Monos_I This 98.1 3.5E-05 8.9E-10 53.1 8.9 72 428-503 83-156 (163) 188 PRK13637 cbiO cobalt transport 98.1 3.7E-05 9.5E-10 52.9 9.0 73 428-504 145-220 (287) 189 PRK13547 hmuV hemin importer A 98.1 8.9E-06 2.3E-10 57.0 5.7 39 6-44 11-50 (273) 190 TIGR03411 urea_trans_UrtD urea 98.1 5E-05 1.3E-09 52.1 9.6 73 427-503 143-216 (242) 191 PRK13631 cbiO cobalt transport 98.1 3.5E-05 8.8E-10 53.1 8.7 73 428-504 177-251 (320) 192 PRK10253 iron-enterobactin tra 98.1 8.9E-06 2.3E-10 57.0 5.7 38 8-45 19-57 (265) 193 TIGR02211 LolD_lipo_ex lipopro 98.1 2.2E-05 5.7E-10 54.4 7.7 70 429-503 143-215 (221) 194 PRK11124 artP arginine transpo 98.1 3E-05 7.6E-10 53.6 8.3 73 428-504 142-216 (242) 195 cd03297 ABC_ModC_molybdenum_tr 98.1 3.5E-05 8.8E-10 53.1 8.6 72 428-503 132-206 (214) 196 cd03234 ABCG_White The White s 98.1 7.7E-06 2E-10 57.4 5.3 40 4-43 11-55 (226) 197 PRK11701 phnK phosphonates tra 98.1 9.8E-06 2.5E-10 56.8 5.8 74 428-505 152-227 (258) 198 PRK13542 consensus 98.1 2.6E-05 6.5E-10 54.0 7.9 67 427-497 147-216 (224) 199 COG1121 ZnuC ABC-type Mn/Zn tr 98.0 5.6E-06 1.4E-10 58.4 4.5 35 11-45 19-54 (254) 200 PRK11614 livF leucine/isoleuci 98.0 5.5E-05 1.4E-09 51.8 9.5 73 428-504 138-212 (237) 201 cd03236 ABC_RNaseL_inhibitor_d 98.0 4.3E-05 1.1E-09 52.5 9.0 72 428-503 140-213 (255) 202 cd03218 ABC_YhbG The ABC trans 98.0 4.8E-05 1.2E-09 52.2 9.1 74 427-504 133-208 (232) 203 PRK10619 histidine/lysine/argi 98.0 5.8E-05 1.5E-09 51.6 9.5 74 428-505 153-227 (257) 204 PRK10636 putative ABC transpor 98.0 1.3E-05 3.3E-10 56.0 6.1 77 421-504 425-501 (638) 205 cd03264 ABC_drug_resistance_li 98.0 7.2E-06 1.8E-10 57.6 4.8 38 6-43 10-47 (211) 206 PRK13538 cytochrome c biogenes 98.0 1.2E-05 3E-10 56.2 5.9 39 7-45 12-51 (204) 207 cd03235 ABC_Metallic_Cations A 98.0 1.3E-05 3.4E-10 55.9 6.2 42 4-45 7-49 (213) 208 cd03293 ABC_NrtD_SsuB_transpor 98.0 4.6E-05 1.2E-09 52.3 8.9 73 428-504 132-207 (220) 209 COG4181 Predicted ABC-type tra 98.0 3.2E-05 8.2E-10 53.4 8.0 75 426-504 145-221 (228) 210 PRK11288 araG L-arabinose tran 98.0 6.5E-05 1.6E-09 51.4 9.5 96 427-536 396-495 (501) 211 cd03220 ABC_KpsT_Wzt ABC_KpsT_ 98.0 5.2E-05 1.3E-09 52.0 9.0 73 427-503 142-216 (224) 212 cd03261 ABC_Org_Solvent_Resist 98.0 6.5E-05 1.7E-09 51.3 9.4 72 428-503 137-211 (235) 213 cd03299 ABC_ModC_like Archeal 98.0 5.1E-05 1.3E-09 52.0 8.9 73 428-504 130-205 (235) 214 PRK13638 cbiO cobalt transport 98.0 1.3E-05 3.2E-10 56.0 5.8 39 7-45 12-51 (271) 215 TIGR03410 urea_trans_UrtE urea 98.0 0.00021 5.2E-09 48.0 11.9 72 428-504 132-206 (230) 216 PRK10575 iron-hydroxamate tran 98.0 1.3E-05 3.4E-10 55.8 5.8 35 8-42 23-58 (265) 217 PRK13631 cbiO cobalt transport 98.0 1.2E-05 3.2E-10 56.1 5.6 36 10-45 40-76 (320) 218 PRK10247 putative ABC transpor 98.0 1.5E-05 3.7E-10 55.6 5.9 38 8-45 19-57 (225) 219 PRK09536 btuD corrinoid ABC tr 98.0 1.3E-05 3.2E-10 56.0 5.6 74 428-505 139-213 (409) 220 PRK13549 xylose transporter AT 98.0 2.8E-05 7E-10 53.8 7.3 37 8-44 17-54 (513) 221 cd03219 ABC_Mj1267_LivG_branch 98.0 6.5E-05 1.6E-09 51.4 9.2 74 427-504 143-218 (236) 222 PRK03695 vitamin B12-transport 98.0 8.7E-05 2.2E-09 50.5 9.8 77 427-503 123-204 (245) 223 PRK09544 znuC high-affinity zi 98.0 1.7E-05 4.2E-10 55.2 6.0 39 7-45 15-54 (251) 224 cd03213 ABCG_EPDR ABCG transpo 98.0 1.5E-05 3.7E-10 55.6 5.6 40 3-42 3-56 (194) 225 PRK09984 phosphonate/organopho 98.0 1.3E-05 3.4E-10 55.9 5.3 39 7-45 15-54 (262) 226 cd03268 ABC_BcrA_bacitracin_re 98.0 8.1E-05 2.1E-09 50.7 9.3 73 427-503 126-200 (208) 227 COG1120 FepC ABC-type cobalami 98.0 6.6E-05 1.7E-09 51.3 8.8 39 8-46 14-53 (258) 228 cd03217 ABC_FeS_Assembly ABC-t 98.0 1.5E-05 3.9E-10 55.5 5.5 38 5-42 9-47 (200) 229 PRK13540 cytochrome c biogenes 98.0 2E-05 5E-10 54.8 6.0 41 5-45 10-51 (200) 230 cd03300 ABC_PotA_N PotA is an 98.0 7.3E-05 1.9E-09 51.0 8.9 71 428-502 131-204 (232) 231 COG0488 Uup ATPase components 98.0 4.1E-05 1E-09 52.7 7.6 77 421-504 434-511 (530) 232 PRK11819 putative ABC transpor 98.0 3E-05 7.6E-10 53.6 6.9 100 422-535 441-540 (556) 233 cd03260 ABC_PstB_phosphate_tra 98.0 2.6E-05 6.6E-10 54.0 6.5 39 7-45 11-50 (227) 234 cd03229 ABC_Class3 This class 98.0 9.3E-05 2.4E-09 50.3 9.3 72 428-503 101-175 (178) 235 PRK13409 putative ATPase RIL; 98.0 9.3E-05 2.4E-09 50.3 9.3 23 20-42 97-120 (590) 236 COG1123 ATPase components of v 98.0 9.3E-05 2.4E-09 50.3 9.3 73 428-504 430-505 (539) 237 PRK13548 hmuV hemin importer A 98.0 2E-05 5E-10 54.8 5.8 38 8-45 14-52 (257) 238 PRK11300 livG leucine/isoleuci 98.0 0.00011 2.7E-09 49.9 9.6 73 427-503 153-228 (255) 239 PRK10895 putative ABC transpor 97.9 2.4E-05 6E-10 54.2 6.1 38 8-45 15-53 (241) 240 cd03233 ABC_PDR_domain1 The pl 97.9 2.1E-05 5.3E-10 54.6 5.8 35 11-45 22-57 (202) 241 PRK13543 cytochrome c biogenes 97.9 2.2E-05 5.5E-10 54.5 5.9 40 6-45 21-61 (214) 242 PTZ00243 ABC transporter; Prov 97.9 0.0001 2.6E-09 50.1 9.2 74 428-504 1446-1519(1560) 243 TIGR02168 SMC_prok_B chromosom 97.9 0.0019 4.9E-08 41.6 18.6 171 1-177 2-196 (1191) 244 cd03231 ABC_CcmA_heme_exporter 97.9 2.4E-05 6.1E-10 54.2 5.9 38 8-45 12-50 (201) 245 PRK10982 galactose/methyl gala 97.9 0.00016 4.2E-09 48.7 10.2 96 427-536 391-489 (491) 246 PRK10744 phosphate transporter 97.9 3.2E-05 8.2E-10 53.4 6.5 38 9-46 23-61 (257) 247 COG1131 CcmA ABC-type multidru 97.9 1.9E-05 4.9E-10 54.8 5.3 74 427-505 136-212 (293) 248 PRK11819 putative ABC transpor 97.9 5.6E-05 1.4E-09 51.7 7.6 33 10-42 21-54 (556) 249 COG1122 CbiO ABC-type cobalt t 97.9 4.8E-05 1.2E-09 52.2 7.2 74 428-505 139-215 (235) 250 PRK11831 putative ABC transpor 97.9 2.3E-05 5.8E-10 54.3 5.5 38 8-45 20-58 (269) 251 PRK11248 tauB taurine transpor 97.9 2.6E-05 6.5E-10 54.0 5.7 72 428-503 129-203 (255) 252 PRK03695 vitamin B12-transport 97.9 1.7E-05 4.5E-10 55.1 4.8 39 4-42 2-44 (245) 253 PRK09493 glnQ glutamine ABC tr 97.9 2.8E-05 7.2E-10 53.7 5.9 37 9-45 14-51 (240) 254 cd03230 ABC_DR_subfamily_A Thi 97.9 0.00015 3.8E-09 49.0 9.5 72 428-503 96-169 (173) 255 cd03266 ABC_NatA_sodium_export 97.9 0.00014 3.5E-09 49.2 9.3 74 427-504 136-211 (218) 256 cd03226 ABC_cobalt_CbiO_domain 97.9 2.2E-05 5.6E-10 54.4 5.3 37 9-45 13-50 (205) 257 cd03271 ABC_UvrA_II The excisi 97.9 1.2E-05 3.2E-10 56.1 4.0 32 12-43 11-43 (261) 258 cd03257 ABC_NikE_OppD_transpor 97.9 2.8E-05 7E-10 53.8 5.7 36 10-45 19-55 (228) 259 cd03221 ABCF_EF-3 ABCF_EF-3 E 97.9 3.5E-05 8.8E-10 53.1 6.2 42 4-45 8-50 (144) 260 PRK11264 putative amino-acid A 97.9 2.7E-05 7E-10 53.8 5.6 72 428-503 143-216 (248) 261 PRK11701 phnK phosphonates tra 97.9 0.00013 3.3E-09 49.4 9.1 37 9-45 19-56 (258) 262 TIGR01842 type_I_sec_PrtD type 97.9 6E-05 1.5E-09 51.6 7.3 69 428-500 467-536 (556) 263 PTZ00265 multidrug resistance 97.9 0.0001 2.6E-09 50.0 8.5 74 427-504 1359-1434(1467) 264 cd03290 ABCC_SUR1_N The SUR do 97.9 2.1E-05 5.5E-10 54.5 4.9 36 8-43 13-49 (218) 265 PRK09700 D-allose transporter 97.9 0.00032 8E-09 46.8 10.9 74 427-504 409-484 (510) 266 cd03256 ABC_PhnC_transporter A 97.9 1.8E-05 4.5E-10 55.1 4.4 37 9-45 14-51 (241) 267 cd03214 ABC_Iron-Siderophores_ 97.9 3.4E-05 8.8E-10 53.2 5.9 41 5-45 8-49 (180) 268 PRK13542 consensus 97.9 3.2E-05 8.2E-10 53.4 5.8 37 9-45 31-68 (224) 269 PRK11629 lolD lipoprotein tran 97.9 3.4E-05 8.6E-10 53.2 5.9 35 11-45 24-59 (233) 270 PRK10762 D-ribose transporter 97.9 0.0005 1.3E-08 45.5 11.8 74 427-504 395-470 (501) 271 cd03224 ABC_TM1139_LivF_branch 97.9 3.4E-05 8.7E-10 53.2 5.8 39 6-44 10-49 (222) 272 PRK11614 livF leucine/isoleuci 97.9 3.9E-05 9.8E-10 52.8 6.1 36 8-43 17-53 (237) 273 cd03265 ABC_DrrA DrrA is the A 97.9 0.00018 4.5E-09 48.5 9.5 74 427-504 131-206 (220) 274 cd03225 ABC_cobalt_CbiO_domain 97.9 2.7E-05 7E-10 53.8 5.3 37 9-45 14-51 (211) 275 TIGR03522 GldA_ABC_ATP gliding 97.9 0.00016 4E-09 48.8 9.1 38 8-45 14-52 (301) 276 PRK11153 metN DL-methionine tr 97.9 0.00015 3.9E-09 48.9 9.1 35 10-44 19-54 (343) 277 cd03238 ABC_UvrA The excision 97.9 1.9E-05 5E-10 54.8 4.4 43 5-47 4-47 (176) 278 PRK13648 cbiO cobalt transport 97.9 2.7E-05 6.8E-10 53.9 5.1 34 11-44 24-58 (269) 279 PRK11247 ssuB aliphatic sulfon 97.9 3.1E-05 7.9E-10 53.5 5.4 38 8-45 24-62 (257) 280 COG4987 CydC ABC-type transpor 97.9 0.00013 3.2E-09 49.5 8.5 78 418-503 469-546 (573) 281 PRK11147 ABC transporter ATPas 97.8 9E-05 2.3E-09 50.4 7.6 39 4-42 4-50 (632) 282 PRK11300 livG leucine/isoleuci 97.8 3.9E-05 1E-09 52.8 5.8 36 8-43 17-53 (255) 283 TIGR03608 L_ocin_972_ABC putat 97.8 2.9E-05 7.5E-10 53.6 5.1 40 6-45 8-48 (206) 284 COG1245 Predicted ATPase, RNas 97.8 7.2E-05 1.8E-09 51.1 7.1 73 428-504 456-530 (591) 285 cd03230 ABC_DR_subfamily_A Thi 97.8 4.4E-05 1.1E-09 52.4 6.0 39 7-45 11-50 (173) 286 PRK10619 histidine/lysine/argi 97.8 3.1E-05 7.8E-10 53.5 5.1 37 9-45 18-55 (257) 287 cd03246 ABCC_Protease_Secretio 97.8 2.4E-05 6.1E-10 54.2 4.5 35 11-45 17-52 (173) 288 PRK10418 nikD nickel transport 97.8 3.6E-05 9.1E-10 53.1 5.4 43 3-45 4-53 (254) 289 TIGR03269 met_CoM_red_A2 methy 97.8 0.00022 5.6E-09 47.8 9.4 89 427-529 427-518 (520) 290 cd03249 ABC_MTABC3_MDL1_MDL2 M 97.8 2.8E-05 7.1E-10 53.8 4.8 35 8-42 15-50 (238) 291 cd03218 ABC_YhbG The ABC trans 97.8 4.3E-05 1.1E-09 52.6 5.7 39 7-45 11-50 (232) 292 cd03295 ABC_OpuCA_Osmoprotecti 97.8 0.00022 5.6E-09 47.8 9.3 72 428-503 136-210 (242) 293 cd03296 ABC_CysA_sulfate_impor 97.8 3.5E-05 9E-10 53.1 5.2 74 427-504 136-211 (239) 294 cd03223 ABCD_peroxisomal_ALDP 97.8 3.1E-05 8E-10 53.4 5.0 33 10-42 15-48 (166) 295 cd03250 ABCC_MRP_domain1 Domai 97.8 2.8E-05 7.2E-10 53.7 4.7 32 11-42 20-52 (204) 296 PRK10982 galactose/methyl gala 97.8 0.00062 1.6E-08 44.9 11.6 38 8-45 10-48 (491) 297 PRK13636 cbiO cobalt transport 97.8 2.9E-05 7.3E-10 53.7 4.7 36 10-45 20-56 (285) 298 cd03296 ABC_CysA_sulfate_impor 97.8 0.00016 4E-09 48.8 8.4 38 8-45 14-52 (239) 299 PRK13646 cbiO cobalt transport 97.8 2.8E-05 7.1E-10 53.8 4.5 35 11-45 22-57 (286) 300 PRK13647 cbiO cobalt transport 97.8 3.4E-05 8.7E-10 53.2 5.0 35 11-45 20-55 (273) 301 KOG0057 consensus 97.8 0.00011 2.9E-09 49.8 7.6 84 414-505 478-561 (591) 302 PRK10771 thiQ thiamine transpo 97.8 6.2E-05 1.6E-09 51.5 6.2 42 4-45 2-49 (233) 303 PRK13644 cbiO cobalt transport 97.8 3.2E-05 8.2E-10 53.4 4.7 36 10-45 16-52 (274) 304 COG2274 SunT ABC-type bacterio 97.8 0.00016 4.1E-09 48.7 8.2 73 428-504 610-682 (709) 305 PRK13645 cbiO cobalt transport 97.8 3.4E-05 8.6E-10 53.2 4.8 35 11-45 26-61 (289) 306 PRK13650 cbiO cobalt transport 97.8 4.2E-05 1.1E-09 52.6 5.2 35 11-45 19-54 (276) 307 PRK11264 putative amino-acid A 97.8 0.00019 4.8E-09 48.3 8.5 37 8-44 13-50 (248) 308 cd03269 ABC_putative_ATPase Th 97.8 4.4E-05 1.1E-09 52.4 5.2 73 427-503 128-202 (210) 309 TIGR03411 urea_trans_UrtD urea 97.8 5.1E-05 1.3E-09 52.0 5.6 36 8-43 14-50 (242) 310 PRK13649 cbiO cobalt transport 97.8 3.2E-05 8.2E-10 53.3 4.5 35 11-45 22-57 (280) 311 PRK13651 cobalt transporter AT 97.8 3.5E-05 8.9E-10 53.1 4.7 36 10-45 21-57 (304) 312 cd03254 ABCC_Glucan_exporter_l 97.8 3.7E-05 9.5E-10 52.9 4.8 33 11-43 18-51 (229) 313 PRK11288 araG L-arabinose tran 97.8 0.00047 1.2E-08 45.7 10.4 35 8-42 16-51 (501) 314 PRK10584 putative ABC transpor 97.8 3.8E-05 9.7E-10 52.9 4.8 36 10-45 24-60 (228) 315 PRK10419 nikE nickel transport 97.8 0.00027 6.8E-09 47.3 9.1 74 428-505 152-227 (266) 316 PRK13642 cbiO cobalt transport 97.8 4.8E-05 1.2E-09 52.2 5.3 34 12-45 23-57 (277) 317 PRK13652 cbiO cobalt transport 97.8 3.7E-05 9.4E-10 53.0 4.7 36 10-45 18-54 (277) 318 cd03293 ABC_NrtD_SsuB_transpor 97.8 4.1E-05 1E-09 52.7 4.9 37 9-45 17-54 (220) 319 KOG0061 consensus 97.8 8.4E-05 2.1E-09 50.6 6.5 36 9-44 43-79 (613) 320 PRK13632 cbiO cobalt transport 97.8 3.9E-05 1E-09 52.8 4.8 35 11-45 25-60 (273) 321 PRK13546 teichoic acids export 97.8 3.3E-05 8.5E-10 53.2 4.4 39 7-45 35-74 (264) 322 PRK09473 oppD oligopeptide tra 97.8 5.1E-05 1.3E-09 52.0 5.4 72 428-504 162-236 (330) 323 cd03251 ABCC_MsbA MsbA is an e 97.8 3.4E-05 8.6E-10 53.2 4.4 33 10-42 16-49 (234) 324 cd03268 ABC_BcrA_bacitracin_re 97.8 5.1E-05 1.3E-09 52.0 5.3 39 7-45 11-50 (208) 325 PRK13634 cbiO cobalt transport 97.8 2.5E-05 6.3E-10 54.1 3.6 36 10-45 8-44 (276) 326 PRK13639 cbiO cobalt transport 97.8 3.9E-05 9.8E-10 52.8 4.6 37 9-45 15-52 (275) 327 TIGR02673 FtsE cell division A 97.8 2E-05 5E-10 54.8 3.1 40 7-46 13-53 (215) 328 cd03259 ABC_Carb_Solutes_like 97.8 5.7E-05 1.5E-09 51.7 5.5 39 7-45 11-50 (213) 329 PRK13635 cbiO cobalt transport 97.8 4.5E-05 1.1E-09 52.4 4.9 35 11-45 22-57 (279) 330 cd03255 ABC_MJ0796_Lo1CDE_FtsE 97.8 4.1E-05 1.1E-09 52.6 4.7 37 9-45 17-54 (218) 331 cd03245 ABCC_bacteriocin_expor 97.8 3.9E-05 1E-09 52.8 4.5 35 10-44 18-53 (220) 332 cd03263 ABC_subfamily_A The AB 97.8 4.8E-05 1.2E-09 52.2 5.0 37 9-45 15-52 (220) 333 cd03244 ABCC_MRP_domain2 Domai 97.7 4.9E-05 1.2E-09 52.2 5.0 32 11-42 19-51 (221) 334 PRK13641 cbiO cobalt transport 97.7 3E-05 7.7E-10 53.5 3.9 34 12-45 23-57 (286) 335 PRK13640 cbiO cobalt transport 97.7 3.5E-05 9E-10 53.1 4.2 35 11-45 23-58 (283) 336 cd03228 ABCC_MRP_Like The MRP 97.7 4E-05 1E-09 52.7 4.5 36 10-45 16-52 (171) 337 cd03248 ABCC_TAP TAP, the Tran 97.7 4.8E-05 1.2E-09 52.2 4.9 33 10-42 28-61 (226) 338 cd03247 ABCC_cytochrome_bd The 97.7 3.9E-05 1E-09 52.8 4.4 36 10-45 16-52 (178) 339 PRK11144 modC molybdate transp 97.7 0.00021 5.5E-09 47.9 8.2 40 4-45 8-48 (352) 340 TIGR02169 SMC_prok_A chromosom 97.7 0.0041 1E-07 39.5 17.8 183 316-505 990-1190(1202) 341 cd03237 ABC_RNaseL_inhibitor_d 97.7 4.3E-05 1.1E-09 52.5 4.6 35 11-45 9-49 (246) 342 TIGR01978 sufC FeS assembly AT 97.7 2.5E-05 6.3E-10 54.1 3.4 39 6-47 10-49 (248) 343 cd03292 ABC_FtsE_transporter F 97.7 5.6E-05 1.4E-09 51.8 5.2 37 8-44 13-50 (214) 344 cd03300 ABC_PotA_N PotA is an 97.7 4.2E-05 1.1E-09 52.6 4.5 38 7-44 11-49 (232) 345 TIGR03410 urea_trans_UrtE urea 97.7 6.3E-05 1.6E-09 51.4 5.4 37 8-44 12-49 (230) 346 PRK10636 putative ABC transpor 97.7 0.00022 5.6E-09 47.8 8.1 33 10-42 15-48 (638) 347 TIGR01420 pilT_fam twitching m 97.7 2.3E-05 6E-10 54.3 3.1 27 20-46 126-152 (350) 348 PRK10851 sulfate/thiosulfate t 97.7 0.00022 5.7E-09 47.8 8.1 36 9-44 15-51 (352) 349 COG3839 MalK ABC-type sugar tr 97.7 4.8E-05 1.2E-09 52.2 4.7 35 11-45 18-53 (338) 350 TIGR02324 CP_lyasePhnL phospho 97.7 2.7E-05 6.9E-10 53.8 3.4 32 10-41 22-54 (224) 351 cd03253 ABCC_ATM1_transporter 97.7 4.3E-05 1.1E-09 52.5 4.4 33 10-42 15-48 (236) 352 PRK09700 D-allose transporter 97.7 0.00039 1E-08 46.2 9.3 35 10-44 19-54 (510) 353 PRK10908 cell division protein 97.7 4.3E-05 1.1E-09 52.5 4.4 36 10-45 16-52 (222) 354 PRK11308 dppF dipeptide transp 97.7 0.00034 8.8E-09 46.6 9.0 72 428-503 155-229 (327) 355 cd03301 ABC_MalK_N The N-termi 97.7 0.00036 9.3E-09 46.4 9.1 72 428-504 131-205 (213) 356 PRK10851 sulfate/thiosulfate t 97.7 4.9E-05 1.2E-09 52.2 4.6 73 428-504 137-212 (352) 357 cd03215 ABC_Carb_Monos_II This 97.7 3.9E-05 1E-09 52.8 4.1 42 4-45 5-50 (182) 358 PRK13643 cbiO cobalt transport 97.7 4.3E-05 1.1E-09 52.5 4.3 35 11-45 21-56 (288) 359 cd03294 ABC_Pro_Gly_Bertaine T 97.7 0.00044 1.1E-08 45.8 9.5 72 428-503 161-235 (269) 360 COG4133 CcmA ABC-type transpor 97.7 4.5E-05 1.2E-09 52.4 4.4 36 10-45 16-52 (209) 361 cd03266 ABC_NatA_sodium_export 97.7 5.7E-05 1.5E-09 51.7 4.8 36 10-45 19-55 (218) 362 PRK00635 excinuclease ABC subu 97.7 0.00025 6.5E-09 47.4 8.1 75 427-502 809-884 (1809) 363 PRK11144 modC molybdate transp 97.7 9.2E-05 2.3E-09 50.3 5.9 74 427-504 128-204 (352) 364 PRK10938 putative molybdenum t 97.7 0.00022 5.5E-09 47.9 7.8 40 3-42 3-50 (490) 365 PRK13637 cbiO cobalt transport 97.7 5.2E-05 1.3E-09 52.0 4.6 35 11-45 22-57 (287) 366 cd03219 ABC_Mj1267_LivG_branch 97.7 9.2E-05 2.3E-09 50.4 5.8 39 7-45 11-50 (236) 367 cd03289 ABCC_CFTR2 The CFTR su 97.7 5.3E-05 1.4E-09 51.9 4.6 35 11-45 19-54 (275) 368 cd03299 ABC_ModC_like Archeal 97.7 5.2E-05 1.3E-09 52.0 4.4 38 7-45 11-49 (235) 369 cd03297 ABC_ModC_molybdenum_tr 97.7 9.5E-05 2.4E-09 50.2 5.8 41 3-45 7-47 (214) 370 cd03267 ABC_NatA_like Similar 97.7 5E-05 1.3E-09 52.1 4.3 38 8-45 33-71 (236) 371 TIGR03522 GldA_ABC_ATP gliding 97.7 7.3E-05 1.9E-09 51.0 5.2 75 427-505 133-207 (301) 372 COG4618 ArpD ABC-type protease 97.7 0.00047 1.2E-08 45.7 9.3 93 428-537 473-566 (580) 373 cd03369 ABCC_NFT1 Domain 2 of 97.7 6.6E-05 1.7E-09 51.3 4.9 35 11-45 23-58 (207) 374 cd03262 ABC_HisP_GlnQ_permease 97.7 5.8E-05 1.5E-09 51.7 4.5 38 8-45 12-50 (213) 375 PRK11124 artP arginine transpo 97.7 0.00012 3E-09 49.6 6.1 36 9-44 15-51 (242) 376 COG1136 SalX ABC-type antimicr 97.7 5.1E-05 1.3E-09 52.0 4.1 37 9-45 18-55 (226) 377 PRK00349 uvrA excinuclease ABC 97.7 0.00031 8E-09 46.8 8.2 74 427-502 830-905 (944) 378 cd03216 ABC_Carb_Monos_I This 97.7 0.0001 2.7E-09 50.0 5.7 39 7-45 11-50 (163) 379 PRK10261 glutathione transport 97.7 0.00037 9.4E-09 46.4 8.5 73 428-504 464-539 (623) 380 cd03261 ABC_Org_Solvent_Resist 97.7 9.9E-05 2.5E-09 50.1 5.5 38 7-44 11-49 (235) 381 cd03291 ABCC_CFTR1 The CFTR su 97.7 6.4E-05 1.6E-09 51.4 4.6 32 11-42 52-84 (282) 382 cd03252 ABCC_Hemolysin The ABC 97.7 5.8E-05 1.5E-09 51.7 4.3 33 11-43 17-50 (237) 383 PRK10762 D-ribose transporter 97.7 0.00031 8E-09 46.8 8.0 37 9-45 17-54 (501) 384 PRK13537 lipooligosaccharide t 97.7 8.8E-05 2.3E-09 50.5 5.2 39 7-45 16-55 (304) 385 cd03265 ABC_DrrA DrrA is the A 97.7 7.9E-05 2E-09 50.8 4.9 39 7-45 11-50 (220) 386 PRK11000 maltose/maltodextrin 97.6 6.7E-05 1.7E-09 51.3 4.4 36 9-44 16-52 (369) 387 cd03288 ABCC_SUR2 The SUR doma 97.6 6.9E-05 1.8E-09 51.2 4.5 34 11-44 36-70 (257) 388 cd03298 ABC_ThiQ_thiamine_tran 97.6 6.6E-05 1.7E-09 51.3 4.4 32 14-45 16-48 (211) 389 COG3638 ABC-type phosphate/pho 97.6 0.0001 2.6E-09 50.1 5.3 35 11-45 19-54 (258) 390 PRK11248 tauB taurine transpor 97.6 0.00067 1.7E-08 44.7 9.4 38 8-45 13-51 (255) 391 PRK09452 potA putrescine/sperm 97.6 0.00012 3E-09 49.7 5.6 37 8-44 29-66 (378) 392 cd03220 ABC_KpsT_Wzt ABC_KpsT_ 97.6 7.6E-05 1.9E-09 50.9 4.6 38 8-45 34-72 (224) 393 PRK11022 dppD dipeptide transp 97.6 0.00052 1.3E-08 45.4 8.8 72 428-503 154-228 (327) 394 PRK09473 oppD oligopeptide tra 97.6 0.00058 1.5E-08 45.1 9.1 35 11-45 31-66 (330) 395 cd03270 ABC_UvrA_I The excisio 97.6 5.6E-05 1.4E-09 51.8 3.8 28 11-38 10-38 (226) 396 PRK13633 cobalt transporter AT 97.6 7.6E-05 1.9E-09 50.9 4.4 35 11-45 26-61 (281) 397 PRK13537 lipooligosaccharide t 97.6 0.00064 1.6E-08 44.8 9.1 73 427-503 136-210 (304) 398 cd03269 ABC_putative_ATPase Th 97.6 0.00076 1.9E-08 44.3 9.5 40 6-45 10-50 (210) 399 cd03295 ABC_OpuCA_Osmoprotecti 97.6 0.00011 2.8E-09 49.9 5.1 37 9-45 14-51 (242) 400 PRK10535 macrolide transporter 97.6 0.00011 2.7E-09 49.9 5.1 13 101-113 62-74 (648) 401 cd03229 ABC_Class3 This class 97.6 0.00011 2.7E-09 49.9 5.0 39 7-45 11-50 (178) 402 cd03301 ABC_MalK_N The N-termi 97.6 0.0001 2.7E-09 50.0 4.9 38 7-44 11-49 (213) 403 PRK13657 cyclic beta-1,2-gluca 97.6 6.1E-05 1.6E-09 51.5 3.7 121 405-536 350-488 (585) 404 PRK11650 ugpC glycerol-3-phosp 97.6 0.00057 1.5E-08 45.1 8.6 36 10-45 18-54 (358) 405 COG4938 Uncharacterized conser 97.6 0.0001 2.7E-09 50.0 4.7 46 1-47 2-47 (374) 406 PRK00409 recombination and DNA 97.6 0.0068 1.7E-07 38.0 14.9 109 438-551 394-509 (780) 407 PRK13536 nodulation factor exp 97.6 0.00013 3.3E-09 49.4 5.2 39 7-45 18-57 (306) 408 PRK10522 multidrug transporter 97.6 6.8E-05 1.7E-09 51.2 3.7 48 406-460 339-387 (547) 409 TIGR02857 CydD ABC transporter 97.6 4.3E-05 1.1E-09 52.5 2.7 31 11-41 367-398 (570) 410 TIGR00958 3a01208 antigen pept 97.6 5.6E-05 1.4E-09 51.8 3.2 77 425-505 668-748 (770) 411 cd03277 ABC_SMC5_euk Eukaryoti 97.6 0.00012 3.1E-09 49.5 4.9 79 410-488 108-190 (213) 412 COG1122 CbiO ABC-type cobalt t 97.6 8.7E-05 2.2E-09 50.5 4.1 37 10-46 18-55 (235) 413 PRK11650 ugpC glycerol-3-phosp 97.6 0.00012 3E-09 49.7 4.7 93 428-535 135-236 (358) 414 TIGR01189 ccmA heme ABC export 97.5 9.5E-05 2.4E-09 50.2 4.1 36 10-45 14-50 (204) 415 TIGR03269 met_CoM_red_A2 methy 97.5 0.0012 3.2E-08 42.9 9.7 37 8-44 12-49 (520) 416 TIGR02868 CydC ABC transporter 97.5 0.00028 7.1E-09 47.2 6.4 64 423-490 497-566 (566) 417 PRK11607 potG putrescine trans 97.5 0.00012 3.1E-09 49.5 4.5 37 9-45 32-69 (377) 418 cd03236 ABC_RNaseL_inhibitor_d 97.5 7.6E-05 2E-09 50.9 3.4 37 7-45 12-50 (255) 419 PRK11160 cysteine/glutathione 97.5 9.8E-05 2.5E-09 50.1 3.9 116 406-536 357-493 (575) 420 PRK13536 nodulation factor exp 97.5 0.001 2.6E-08 43.5 9.0 74 427-504 138-213 (306) 421 TIGR03007 pepcterm_ChnLen poly 97.5 0.0084 2.1E-07 37.4 18.0 260 155-450 167-453 (510) 422 COG1117 PstB ABC-type phosphat 97.5 0.00049 1.2E-08 45.6 7.3 40 5-44 16-56 (253) 423 KOG0962 consensus 97.5 0.0087 2.2E-07 37.3 26.5 79 429-507 1185-1277(1294) 424 COG4674 Uncharacterized ABC-ty 97.5 5.6E-05 1.4E-09 51.7 2.5 37 6-42 15-52 (249) 425 PRK10789 putative multidrug tr 97.5 7.4E-05 1.9E-09 51.0 3.1 121 405-536 330-468 (569) 426 PRK10261 glutathione transport 97.5 0.00076 1.9E-08 44.3 8.2 42 4-45 13-66 (623) 427 PRK11174 cysteine/glutathione 97.5 0.00014 3.6E-09 49.2 4.3 48 406-460 366-413 (588) 428 cd03222 ABC_RNaseL_inhibitor T 97.5 9.7E-05 2.5E-09 50.2 3.5 35 8-43 12-47 (177) 429 PRK00635 excinuclease ABC subu 97.5 0.00097 2.5E-08 43.6 8.5 75 427-502 1699-1774(1809) 430 COG0396 sufC Cysteine desulfur 97.5 0.00013 3.3E-09 49.3 4.0 39 3-41 3-50 (251) 431 PRK11022 dppD dipeptide transp 97.5 0.0002 5E-09 48.2 4.8 35 11-45 22-57 (327) 432 COG1126 GlnQ ABC-type polar am 97.5 0.00013 3.2E-09 49.4 3.8 73 428-504 137-211 (240) 433 PRK09452 potA putrescine/sperm 97.5 0.0014 3.5E-08 42.6 9.0 96 428-538 148-252 (378) 434 PRK10790 putative multidrug tr 97.4 0.0001 2.6E-09 50.0 3.1 118 406-536 357-493 (593) 435 PRK11176 lipid transporter ATP 97.4 8.9E-05 2.3E-09 50.4 2.7 48 406-460 358-406 (581) 436 cd03294 ABC_Pro_Gly_Bertaine T 97.4 0.00015 3.7E-09 49.0 3.8 37 9-45 37-74 (269) 437 PRK11153 metN DL-methionine tr 97.4 0.00022 5.5E-09 47.9 4.7 73 428-504 141-215 (343) 438 COG1116 TauB ABC-type nitrate/ 97.4 0.00033 8.3E-09 46.7 5.4 37 9-45 16-53 (248) 439 TIGR01188 drrA daunorubicin re 97.4 0.00012 3E-09 49.6 3.1 69 8-100 7-76 (343) 440 TIGR03265 PhnT2 putative 2-ami 97.4 0.00021 5.4E-09 47.9 4.3 37 8-44 16-53 (353) 441 PRK11432 fbpC ferric transport 97.4 0.0002 5.1E-09 48.1 4.2 34 9-42 19-53 (351) 442 TIGR03258 PhnT 2-aminoethylpho 97.4 0.00021 5.4E-09 47.9 4.3 37 8-44 17-54 (362) 443 cd03258 ABC_MetN_methionine_tr 97.4 0.00019 4.8E-09 48.3 4.0 37 9-45 18-55 (233) 444 TIGR01166 cbiO cobalt ABC tran 97.4 0.00065 1.7E-08 44.7 6.7 65 419-488 120-185 (190) 445 COG4988 CydD ABC-type transpor 97.4 0.00016 4E-09 48.8 3.5 68 412-494 341-408 (559) 446 TIGR03415 ABC_choXWV_ATP choli 97.4 0.00024 6.2E-09 47.5 4.3 36 10-45 38-74 (382) 447 COG1117 PstB ABC-type phosphat 97.4 0.00027 6.9E-09 47.3 4.4 67 428-498 150-216 (253) 448 COG4619 ABC-type uncharacteriz 97.3 0.00028 7.2E-09 47.1 4.4 36 11-46 18-54 (223) 449 PRK10070 glycine betaine trans 97.3 0.00027 6.9E-09 47.3 4.3 36 10-45 42-78 (400) 450 PRK10419 nikE nickel transport 97.3 0.0003 7.7E-09 46.9 4.5 33 10-42 26-59 (266) 451 PRK11607 potG putrescine trans 97.3 0.0027 6.9E-08 40.7 9.3 72 428-504 150-224 (377) 452 KOG1029 consensus 97.3 0.014 3.6E-07 35.9 18.2 237 137-375 339-586 (1118) 453 KOG0058 consensus 97.3 0.0019 4.9E-08 41.7 8.5 74 427-504 604-677 (716) 454 TIGR00968 3a0106s01 sulfate AB 97.3 0.00039 9.9E-09 46.2 4.8 55 8-63 12-67 (241) 455 KOG0065 consensus 97.3 0.00018 4.6E-09 48.4 3.0 49 447-495 946-995 (1391) 456 TIGR00630 uvra excinuclease AB 97.3 0.00019 4.9E-09 48.3 3.1 105 359-498 478-588 (956) 457 KOG0062 consensus 97.3 0.0012 3.1E-08 43.0 7.1 76 421-503 477-553 (582) 458 COG5265 ATM1 ABC-type transpor 97.3 0.0014 3.7E-08 42.5 7.5 91 428-537 400-490 (497) 459 KOG0054 consensus 97.3 0.00032 8.2E-09 46.8 4.0 75 426-502 1268-1346(1381) 460 PRK11432 fbpC ferric transport 97.3 0.0018 4.5E-08 41.9 7.8 71 428-502 137-210 (351) 461 TIGR02204 MsbA_rel ABC transpo 97.3 0.00015 3.9E-09 48.9 2.3 80 417-504 470-549 (576) 462 COG1132 MdlB ABC-type multidru 97.3 0.00031 7.8E-09 46.9 3.8 118 406-537 345-483 (567) 463 COG3840 ThiQ ABC-type thiamine 97.3 0.0019 4.7E-08 41.8 7.8 71 428-502 130-202 (231) 464 PRK00349 uvrA excinuclease ABC 97.3 0.0021 5.2E-08 41.4 8.0 75 427-503 489-564 (944) 465 TIGR00954 3a01203 Peroxysomal 97.3 0.00012 3.1E-09 49.6 1.7 67 421-495 703-771 (788) 466 PRK11308 dppF dipeptide transp 97.3 0.00031 7.9E-09 46.9 3.8 33 11-43 30-63 (327) 467 COG3842 PotA ABC-type spermidi 97.3 0.0005 1.3E-08 45.5 4.8 35 8-42 17-52 (352) 468 TIGR01166 cbiO cobalt ABC tran 97.2 0.0002 5.2E-09 48.1 2.6 35 11-45 7-42 (190) 469 KOG0064 consensus 97.2 0.00048 1.2E-08 45.6 4.5 103 422-537 607-714 (728) 470 pfam00261 Tropomyosin Tropomyo 97.2 0.018 4.7E-07 35.2 18.8 48 335-383 187-234 (237) 471 PRK11000 maltose/maltodextrin 97.2 0.0025 6.4E-08 40.9 8.1 72 428-504 134-208 (369) 472 TIGR02525 plasmid_TraJ plasmid 97.2 0.00021 5.2E-09 48.0 2.5 29 19-47 147-175 (374) 473 TIGR03258 PhnT 2-aminoethylpho 97.2 0.004 1E-07 39.6 9.1 98 428-539 138-244 (362) 474 COG0411 LivG ABC-type branched 97.2 0.0001 2.7E-09 50.0 1.0 37 9-45 17-54 (250) 475 COG1125 OpuBA ABC-type proline 97.2 0.00062 1.6E-08 44.9 5.0 39 7-45 12-51 (309) 476 COG1129 MglA ABC-type sugar tr 97.2 0.00039 1E-08 46.2 3.9 77 422-503 397-475 (500) 477 COG0410 LivF ABC-type branched 97.2 0.00068 1.7E-08 44.6 5.1 36 11-46 18-54 (237) 478 cd03284 ABC_MutS1 MutS1 homolo 97.2 0.015 3.7E-07 35.8 11.8 28 16-43 25-52 (216) 479 COG1124 DppF ABC-type dipeptid 97.2 0.0018 4.7E-08 41.8 7.2 73 428-504 142-216 (252) 480 COG2274 SunT ABC-type bacterio 97.2 0.00041 1E-08 46.1 3.7 48 406-460 489-537 (709) 481 COG3845 ABC-type uncharacteriz 97.2 0.0005 1.3E-08 45.5 4.0 108 411-536 390-501 (501) 482 COG0488 Uup ATPase components 97.2 0.0018 4.7E-08 41.8 6.9 36 10-45 17-53 (530) 483 TIGR03415 ABC_choXWV_ATP choli 97.2 0.0061 1.5E-07 38.4 9.5 10 22-31 5-14 (382) 484 COG4178 ABC-type uncharacteriz 97.1 0.0027 6.8E-08 40.7 7.7 81 422-506 510-590 (604) 485 TIGR02633 xylG D-xylose ABC tr 97.1 0.00094 2.4E-08 43.7 5.3 80 420-504 398-479 (501) 486 COG1126 GlnQ ABC-type polar am 97.1 0.0029 7.5E-08 40.4 7.7 37 9-45 15-52 (240) 487 pfam04310 MukB MukB N-terminal 97.1 0.0011 2.9E-08 43.1 5.5 44 2-45 8-51 (227) 488 KOG0060 consensus 97.1 0.00081 2.1E-08 44.1 4.7 75 422-502 565-639 (659) 489 COG0444 DppD ABC-type dipeptid 97.1 0.0061 1.6E-07 38.3 9.1 38 9-46 18-56 (316) 490 PRK10070 glycine betaine trans 97.1 0.0071 1.8E-07 37.9 9.4 12 102-113 83-94 (400) 491 COG0178 UvrA Excinuclease ATPa 97.1 0.012 3.1E-07 36.4 10.5 97 427-532 822-919 (935) 492 TIGR03375 type_I_sec_LssB type 97.1 0.00032 8E-09 46.8 2.4 48 406-460 481-529 (694) 493 KOG0061 consensus 97.1 0.0006 1.5E-08 45.0 3.8 17 103-119 89-105 (613) 494 COG1118 CysA ABC-type sulfate/ 97.1 0.00059 1.5E-08 45.0 3.7 40 7-46 13-53 (345) 495 TIGR00960 3a0501s02 Type II (G 97.1 0.00056 1.4E-08 45.2 3.5 31 12-42 19-50 (216) 496 TIGR00606 rad50 rad50; InterPr 97.0 0.027 6.9E-07 34.1 24.4 95 412-507 1193-1310(1328) 497 TIGR02533 type_II_gspE general 97.0 0.00035 8.8E-09 46.5 2.3 19 22-40 246-264 (495) 498 cd03243 ABC_MutS_homologs The 97.0 0.00092 2.3E-08 43.8 4.3 30 16-45 23-53 (202) 499 COG1127 Ttg2A ABC-type transpo 97.0 0.0059 1.5E-07 38.4 8.4 73 428-504 146-221 (263) 500 PRK13545 tagH teichoic acids e 97.0 0.001 2.6E-08 43.5 4.5 36 7-42 35-71 (549) No 1 >PRK10869 recombination and repair protein; Provisional Probab=100.00 E-value=0 Score=1078.96 Aligned_cols=549 Identities=31% Similarity=0.506 Sum_probs=523.7 Q ss_pred CCEEEEECCEEEEEEEEECCCCEEEEECCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCEEEEEEEEECCCCHHHHHHHH Q ss_conf 92599942278999988738981899889997888999999987147325331128972589999997289737888887 Q gi|255764514|r 1 MTRLSIYNIVLIESLDIDFSAGLSILSGDTGSGKSILLDALILVTGGRGDGGLVRRHAEKGQVVAVFEISHLPALEILFA 80 (554) Q Consensus 1 L~~L~i~Nf~~i~~~~i~f~~Gl~vItGetGaGKS~ildAl~~~lG~r~~~~~Ir~g~~~a~Ve~~F~~~~~~~~~~~~~ 80 (554) |.+|+|+||++|++++|+|++||||||||||||||+|||||.++||+|+++++||+|+++|+|+++|++++.+....|+. T Consensus 2 L~~L~I~n~alI~~~~l~f~~Gl~viTGETGAGKSill~al~lllG~ra~~~~ir~g~~~a~vea~F~~~~~~~~~~~l~ 81 (553) T PRK10869 2 LAQLTISNFAIVRELEIDFQSGMTVITGETGAGKSIAIDALGLCLGGRAEASMVRPGATRADLCARFSLKDTPAALRWLE 81 (553) T ss_pred CCEEEEEEEEEEEEEEEECCCCCEEEECCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCEEEEEEEEECCCCHHHHHHHH T ss_conf 87399830587898999769998687789998799999999998488988464669997599999997288757899998 Q ss_pred HCCCCCCCCEEEEEEEECCCCEEEEECCEEEECHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHCCHHHHHHHHH Q ss_conf 47898888389999994389779999998841011222111000001220000000036787777663000013899999 Q gi|255764514|r 81 EANLTLEKHVILRRVQFPDGRTKAYVNDQVVSVNFMRAVGSLLIEIHSQHADRSLLDVQGHRKILDSYADIDLSLCELGT 160 (554) Q Consensus 81 ~~~~~~~~~~iirR~i~~~GkS~~~INg~~v~~~~L~~l~~~lidi~gQ~e~~~Ll~~~~q~~lLD~~~~~~~~~~~~~~ 160 (554) +++++.++++|+||+|+++|||+|||||+|||++.|++++..||||||||+++.|+++++|+.+||.|++...++.+|+. T Consensus 82 ~~~~~~~~eliirR~i~~~GrSr~~INg~~vt~~~Lk~l~~~LidIHgQhe~q~Ll~~~~q~~lLD~f~~~~~l~~~~~~ 161 (553) T PRK10869 82 DNQLEDGNECLLRRVISSDGRSRGFINGTPVPLSQLRELGQLLIQIHGQHAHQLLLKPEHQKTLLDSYANHTSLLQEMAA 161 (553) T ss_pred HCCCCCCCCEEEEEEECCCCCEEEEECCEECCHHHHHHHHHHHHHHHCCHHHHHHHCCHHHHHHHHHHCCCHHHHHHHHH T ss_conf 56999888579999986899658999999856999999999999985236678770832589999863486999999999 Q ss_pred HHHHHHHHHHHHHHHHHH-HHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHC--CCC Q ss_conf 999999999888776655-55433444433211000002344334677788898620001232102345553200--100 Q gi|255764514|r 161 LYRHWCCTADALKKYQEQ-KSSSQDVEFLRFSIDELQALAVQPGEENELVVMRSKILKQERIAVELSSIMDDFHK--SSS 237 (554) Q Consensus 161 ~~~~~~~~~~~l~~l~~~-~~~~~e~e~l~~ql~El~~~~l~~~E~e~L~~~~~~l~~~e~l~~~l~~~~~~l~~--~~~ 237 (554) .|..|+...++++++... .+..+++|+++||++||++++|+++|+++|..+++++.|.+++...+......+.+ ..+ T Consensus 162 ~y~~~~~~~~~l~~l~~~~~~~~~~~d~L~~ql~Ei~~~~l~~gE~eeL~~e~~~L~n~e~i~~~~~~~~~~L~~~e~~~ 241 (553) T PRK10869 162 AYQLWHQSCRDLAQLQQQSQERAARKQLLQYQLKELNEFAPQPGEFEQIDEEYKRLANSGQLLTTSQNALALLADGEEVN 241 (553) T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHH T ss_conf 99999999999999999899999999999999999985699997099999999998669999999999998751787202 Q ss_pred HHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHCCCHH Q ss_conf 17999999986543100110013667642221001079999999875300014876401235666788887876201115 Q gi|255764514|r 238 PISVISSMLRRLERKSTEVPDLLQKSISFLNEAQENLSDAQHEIERSFSEIQYDAQELANIEERLFALRAMSRKYSVSID 317 (554) Q Consensus 238 ~l~~l~~~~~~l~~~~~~~~~~l~~~~~~l~~~~~~l~e~~~el~~~~~~le~~~~~L~~ie~Rl~~l~~L~rK~~~~~e 317 (554) ..+.+......+.. ...++..+....+.++++..+++|+..+++.+.+.+++||.+|+++++|++.+++|+|||+++++ T Consensus 242 ~~~~L~~~~~~l~~-l~~~d~~l~~~~e~l~~a~~~l~e~~~~L~~~~~~le~Dp~~Le~ie~RL~~i~~L~RKyg~~~e 320 (553) T PRK10869 242 ILSQLYTAKQLVSE-LVGMDSKLSGVLDMLEEALIQIQEASDELRHYLDRLDLDPNRLFELEQRLSKQISLARKHHVSPE 320 (553) T ss_pred HHHHHHHHHHHHHH-HHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHCCCHH T ss_conf 99999999999999-87458668999999999999999999999999873568847689999999999999988399999 Q ss_pred HHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEEEECC Q ss_conf 68887520000266644334577777888887676521113667899999998889999976665202563378652025 Q gi|255764514|r 318 QLPELAKKMEEDLADISEGNEKVVSLERVLYEARQAYDRVAQDISTKRYQFAKMLEKNVMAEMPALKLENVCFTVNITSD 397 (554) Q Consensus 318 el~~~~~~l~~~l~~l~~~~~~l~~l~~~~~~~~~~l~~~a~~Ls~~R~~~a~~L~~~i~~~L~~L~m~~a~f~i~~~~~ 397 (554) ++.+++++++.++..+++.+..+.++++++..++++|.+.|.+||..|+++|++|++.|+.+|++|+|++++|.|.+.+. T Consensus 321 eLl~~~~~l~~eL~~l~~~~~~l~~L~~~~~~~~~~~~~~A~~Ls~~R~~aA~~L~~~I~~~L~~L~M~~a~F~i~i~~~ 400 (553) T PRK10869 321 ELPQHHQSLLEEQQQLDDQEDKLETLALAVEKHHQQALETARKLHQSRQRYAKELAKLITQSMHELSMPHGKFTIDVKFD 400 (553) T ss_pred HHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCEEEEEEECC T ss_conf 99999999999998630879999999999999999999999999999999999999999999860299974899999617 Q ss_pred CCCCCCCCCCCCEEEEECCCCCCCCHHHHHHCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHH Q ss_conf 32234465432001101278998311354406215799999999984366899769980344688879999999999997 Q gi|255764514|r 398 KEDISPDGIDRVEFYVQTNRGENPGPLMKLASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQL 477 (554) Q Consensus 398 ~~~~~~~G~d~v~f~~s~n~g~~~~pl~kiaSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~l 477 (554) ++.++++|+|+|+|+||||||+|++||+|||||||+||+||||+++++..+++||+||||||+||||++|..||++|++| T Consensus 401 ~~~~~~~G~d~vefl~s~N~G~~~~pL~kiASGGElSRimLAlk~v~a~~~~~~tlIFDEID~GigG~~a~~vg~~L~~l 480 (553) T PRK10869 401 EHHLSADGADRIEFRVTTNPGQPLQPIAKVASGGELSRIALAIQVITARKMETPALIFDEVDVGISGPTAAVVGKLLRQL 480 (553) T ss_pred CCCCCCCCCEEEEEEEECCCCCCCCCHHHHCCHHHHHHHHHHHHHHHHCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHH T ss_conf 66789998638999995289999761777636608999999999997057999828985788899879999999999998 Q ss_pred HHCCCEEEEECHHHHHHHCCCEEEEEEEECCCCCCEEEEEEEECCHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHC Q ss_conf 3059399980837986501761799996216875258999997598899999999866880028999999988735 Q gi|255764514|r 478 SKKIQLLAVTHAPQVAARADRHFLVYKTNKPDDTQRIETYVAVLTPQERREEIARMLAGSHITEEARAAAEILLEF 553 (554) Q Consensus 478 s~~~Qvi~ITH~pqvAa~a~~h~~v~K~~~~~~~~~~~~~i~~l~~~~r~~Eiarml~g~~~~~~~~~~A~~ll~~ 553 (554) |+++|||||||+|||||+||+||+|+|...++ +|+|.|+.|++++|+.||||||||..||++|++||++||.. T Consensus 481 s~~~QVi~ITHlpQvAa~ad~H~~V~K~~~~~---~t~t~i~~L~~~eRv~EiARMlsG~~it~~al~~A~eLL~a 553 (553) T PRK10869 481 GESTQVMCVTHLPQVAGCGHQHMFVSKETDGG---MTETHMQPLDKKARLQELARLLGGSEVTRNTLANAKELLAA 553 (553) T ss_pred HCCCEEEEECCHHHHHHCCCCEEEEEEECCCC---EEEEEEEECCHHHHHHHHHHHHCCCCCCHHHHHHHHHHHCC T ss_conf 52987999803699985448778999973798---26898788984079999999847998769999999998659 No 2 >COG0497 RecN ATPase involved in DNA repair [DNA replication, recombination, and repair] Probab=100.00 E-value=0 Score=1052.04 Aligned_cols=548 Identities=41% Similarity=0.647 Sum_probs=524.5 Q ss_pred CCEEEEECCEEEEEEEEECCCCEEEEECCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCEEEEEEEEECCCCHHHHHHHH Q ss_conf 92599942278999988738981899889997888999999987147325331128972589999997289737888887 Q gi|255764514|r 1 MTRLSIYNIVLIESLDIDFSAGLSILSGDTGSGKSILLDALILVTGGRGDGGLVRRHAEKGQVVAVFEISHLPALEILFA 80 (554) Q Consensus 1 L~~L~i~Nf~~i~~~~i~f~~Gl~vItGetGaGKS~ildAl~~~lG~r~~~~~Ir~g~~~a~Ve~~F~~~~~~~~~~~~~ 80 (554) |.+|+|+||++|++++|+|++||||||||||||||+|||||.++||+|+++++||+|++++.|++.|+++ .+....|+. T Consensus 2 L~~LsIknfaiIe~L~leF~~GltVlTGETGAGKSIiidAl~lllG~ra~~~~VR~G~~~a~v~a~F~~~-~~~~~~~L~ 80 (557) T COG0497 2 LLELSIKNFAIIEELELEFEKGLTVLTGETGAGKSIIIDALGLLLGGRADASLVRHGAKRAEVEAIFDLD-NPPARAWLE 80 (557) T ss_pred CCEEEEEHEEEEEEEEEECCCCCEEEECCCCCCHHHHHHHHHHHHCCCCCCCHHCCCCCEEEEEEEECCC-CHHHHHHHH T ss_conf 7377450100102122410689568656888756679989999727877811211788606899985479-668899999 Q ss_pred HCCCCCCCCEEEEEEEECCCCEEEEECCEEEECHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHCCHHHHH-HHH Q ss_conf 4789888838999999438977999999884101122211100000122000000003678777766300001389-999 Q gi|255764514|r 81 EANLTLEKHVILRRVQFPDGRTKAYVNDQVVSVNFMRAVGSLLIEIHSQHADRSLLDVQGHRKILDSYADIDLSLC-ELG 159 (554) Q Consensus 81 ~~~~~~~~~~iirR~i~~~GkS~~~INg~~v~~~~L~~l~~~lidi~gQ~e~~~Ll~~~~q~~lLD~~~~~~~~~~-~~~ 159 (554) +.++++++++|+||.|+++|||+|||||++||++.|++++..||+|||||+++.|++|..|+.+||.|++...... .|+ T Consensus 81 e~gie~~~~iilrR~i~~~GrSr~~INg~~Vs~~~L~~l~~~Li~IHGQh~~q~Ll~~~~~r~lLD~f~~~~~~~~~~~~ 160 (557) T COG0497 81 ENGIEDDEEVILRRVISADGRSRAFINGQPVSLAQLKELGQLLIDIHGQHEHQSLLKPELQRQLLDAFAGLEELAQEAYQ 160 (557) T ss_pred HCCCCCCCCEEEEEEECCCCCEEEEECCEEEEHHHHHHHHHHHEEEECCCHHHHHCCHHHHHHHHHHHCCCHHHHHHHHH T ss_conf 75999767579998872778616889999830999999997660122663177761948899999874575578999999 Q ss_pred HHHHHHHHHHHHHHHHHHH-HHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHCCC-- Q ss_conf 9999999999888776655-5543344443321100000234433467778889862000123210234555320010-- Q gi|255764514|r 160 TLYRHWCCTADALKKYQEQ-KSSSQDVEFLRFSIDELQALAVQPGEENELVVMRSKILKQERIAVELSSIMDDFHKSS-- 236 (554) Q Consensus 160 ~~~~~~~~~~~~l~~l~~~-~~~~~e~e~l~~ql~El~~~~l~~~E~e~L~~~~~~l~~~e~l~~~l~~~~~~l~~~~-- 236 (554) ..|+.|+...+++..++.. ++..++.|+|+||++||+.++|+++|+++|..++++|+|.+++...+....+.+++.. T Consensus 161 ~~y~~w~~~~~~l~~~~~~~~e~~~~~d~L~fq~~Ele~~~l~~gE~e~L~~e~~rLsn~ekl~~~~~~a~~~L~ge~~~ 240 (557) T COG0497 161 EAYQAWKQARRELEDLQEKERERAQRADLLQFQLEELEELNLQPGEDEELEEERKRLSNSEKLAEAIQNALELLSGEDDT 240 (557) T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCC T ss_conf 99999999999999999879999999999999999997369999659999999999755899999999999997178874 Q ss_pred -CHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHCCC Q ss_conf -0179999999865431001100136676422210010799999998753000148764012356667888878762011 Q gi|255764514|r 237 -SPISVISSMLRRLERKSTEVPDLLQKSISFLNEAQENLSDAQHEIERSFSEIQYDAQELANIEERLFALRAMSRKYSVS 315 (554) Q Consensus 237 -~~l~~l~~~~~~l~~~~~~~~~~l~~~~~~l~~~~~~l~e~~~el~~~~~~le~~~~~L~~ie~Rl~~l~~L~rK~~~~ 315 (554) +.+..+....+.+.. ..+++..+......+.+++.+++++..+++.+.+.+++||.+|+++++|+..+..++|||+++ T Consensus 241 ~~~~~~l~~a~~~l~~-~~~~d~~l~~~~~~l~ea~~~l~ea~~el~~~~~~le~Dp~~L~~ve~Rl~~L~~l~RKY~~~ 319 (557) T COG0497 241 VSALSLLGRALEALED-LSEYDGKLSELAELLEEALYELEEASEELRAYLDELEFDPNRLEEVEERLFALKSLARKYGVT 319 (557) T ss_pred HHHHHHHHHHHHHHHH-HHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHCCC T ss_conf 3589999999999987-630576689999999999999999999999987437889899999999999999999870999 Q ss_pred HHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEEEE Q ss_conf 15688875200002666443345777778888876765211136678999999988899999766652025633786520 Q gi|255764514|r 316 IDQLPELAKKMEEDLADISEGNEKVVSLERVLYEARQAYDRVAQDISTKRYQFAKMLEKNVMAEMPALKLENVCFTVNIT 395 (554) Q Consensus 316 ~eel~~~~~~l~~~l~~l~~~~~~l~~l~~~~~~~~~~l~~~a~~Ls~~R~~~a~~L~~~i~~~L~~L~m~~a~f~i~~~ 395 (554) ++++.++++++..+++.|++.+..+..|++++..++.+|.+.+..||..|+++|..|++.|+.+|++|+|++++|.|.+. T Consensus 320 ~~~l~~~~~~~~~el~~L~~~~~~~~~Le~~~~~l~~~~~~~A~~Ls~~R~~~A~~L~~~v~~eL~~L~Me~a~F~ve~~ 399 (557) T COG0497 320 IEDLLEYLDKIKEELAQLDNSEESLEALEKEVKKLKAELLEAAEALSAIRKKAAKELEKEVTAELKALAMEKARFTVELK 399 (557) T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEEEC T ss_conf 88999999999999998553066899999999999999999999998999999999999999998860688865899962 Q ss_pred CCCCCCCCCCCCCCEEEEECCCCCCCCHHHHHHCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHH Q ss_conf 25322344654320011012789983113544062157999999999843668997699803446888799999999999 Q gi|255764514|r 396 SDKEDISPDGIDRVEFYVQTNRGENPGPLMKLASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLK 475 (554) Q Consensus 396 ~~~~~~~~~G~d~v~f~~s~n~g~~~~pl~kiaSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~ 475 (554) +...++++.|.|+|+|+||||||+|++||.|||||||+||+||||+++++.....|++||||||+||||++|..||++|+ T Consensus 400 ~~~~~~t~~G~d~VeF~istNpG~~~~pL~KvASGGELSRimLAlk~i~~~~~~~ptlIFDEVD~GIsG~~A~aVg~~L~ 479 (557) T COG0497 400 PLEESPTADGADKVEFLISTNPGEPLKPLAKVASGGELSRIMLALKVILSRKDDTPTLIFDEVDTGISGRVAQAVGKKLR 479 (557) T ss_pred CCCCCCCCCCCCEEEEEEECCCCCCCCCHHHHCCHHHHHHHHHHHHHHHHCCCCCCEEEEECCCCCCCHHHHHHHHHHHH T ss_conf 48877776775218999737999998407765353179999999999971668998599746457997599999999999 Q ss_pred HHHHCCCEEEEECHHHHHHHCCCEEEEEEEECCCCCCEEEEEEEECCHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHC Q ss_conf 973059399980837986501761799996216875258999997598899999999866880028999999988735 Q gi|255764514|r 476 QLSKKIQLLAVTHAPQVAARADRHFLVYKTNKPDDTQRIETYVAVLTPQERREEIARMLAGSHITEEARAAAEILLEF 553 (554) Q Consensus 476 ~ls~~~Qvi~ITH~pqvAa~a~~h~~v~K~~~~~~~~~~~~~i~~l~~~~r~~Eiarml~g~~~~~~~~~~A~~ll~~ 553 (554) +||+++|||||||+|||||+||+||+|.|...++ +|.|.|+.|+.++|++||||||||..+|++|+.||++||+. T Consensus 480 ~Ls~~~QVl~VTHlPQVAa~ad~H~~V~K~~~~~---~T~s~V~~L~~eeRveEiARMl~G~~iT~~a~a~AkeLL~~ 554 (557) T COG0497 480 RLSEHHQVLCVTHLPQVAAMADTHFLVEKESEDG---RTESRVRPLDKEERVEEIARMLGGSEVTDEALAHAKELLAA 554 (557) T ss_pred HHHCCCEEEEEECHHHHHHHHCCEEEEEEECCCC---CEEEEEEECCHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHH T ss_conf 9836964999935787875202558999724788---26776353887678999999856843149999999999975 No 3 >TIGR00634 recN DNA repair protein RecN; InterPro: IPR004604 DNA repair protein RecN is thought to be DNA damage inducible and involved in recombinational processes. The N-terminal region of most of the bacterial RecN proteins sequenced to date contains an ATP/GTP binding domain within an SMC-like motif. SMC-like domains are involved in chromosomal scaffolding and segregation. It is possible that the function of RecN in homologous recombination is either structural or enzymatic or both. RecN may be involved in the proper positioning of the recombining segments of DNA, ensuring normal recombination. The observation that inactivation of this gene leads to a decreased transformation efficiency, as well as increased sensitivity to DNA-damaging agents, may be due to some defect in chromosomal partitioning or positioning during these recombination-dependent processes . The protein may function presynaptically to process double-stranded breaks to produce 3 single-stranded DNA intermediates during recombination. ; GO: 0005524 ATP binding, 0006281 DNA repair, 0006310 DNA recombination. Probab=100.00 E-value=0 Score=1010.42 Aligned_cols=549 Identities=34% Similarity=0.536 Sum_probs=509.9 Q ss_pred CCEEEEECCEEEEEEEEECCCCEEEEECCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCEEEEEEEEECCCCH----HHH Q ss_conf 9259994227899998873898189988999788899999998714732533112897258999999728973----788 Q gi|255764514|r 1 MTRLSIYNIVLIESLDIDFSAGLSILSGDTGSGKSILLDALILVTGGRGDGGLVRRHAEKGQVVAVFEISHLP----ALE 76 (554) Q Consensus 1 L~~L~i~Nf~~i~~~~i~f~~Gl~vItGetGaGKS~ildAl~~~lG~r~~~~~Ir~g~~~a~Ve~~F~~~~~~----~~~ 76 (554) |.+|+|+||++|+.++|+|+.||||||||||||||++||||.|++|+|+++++||.|+++|+|+++|..++.+ ... T Consensus 2 L~~L~I~Nfa~I~~l~~eF~rGltVLTGETGaGKSm~i~Al~LL~G~r~~~~~vR~G~~~A~~eg~F~~~~~~~~~V~~~ 81 (605) T TIGR00634 2 LTELRINNFALIRELTVEFERGLTVLTGETGAGKSMIIDALSLLLGQRAGASLVRSGENRAVVEGVFTTESEDDVPVADY 81 (605) T ss_pred CCEEEEHHHHHHHHHHHHHHCCCCEEECCCCCCHHHHHHHHHHCCCCCCCCCEEECCCCCEEEEEEEEECCCCCCCCCCC T ss_conf 63023045456777677662687143046455078877669870588547631233787147898885057777501012 Q ss_pred HHHHHCCCCCC---CCEEEEEEEECCCCEEEEECCEEEECHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHCCH- Q ss_conf 88874789888---83899999943897799999988410112221110000012200000000367877776630000- Q gi|255764514|r 77 ILFAEANLTLE---KHVILRRVQFPDGRTKAYVNDQVVSVNFMRAVGSLLIEIHSQHADRSLLDVQGHRKILDSYADID- 152 (554) Q Consensus 77 ~~~~~~~~~~~---~~~iirR~i~~~GkS~~~INg~~v~~~~L~~l~~~lidi~gQ~e~~~Ll~~~~q~~lLD~~~~~~- 152 (554) .|.....+..+ ..++++|.+.++|||+|||||+|||.+.|+++...||+|||||++|.||++++||.+||.||+.. T Consensus 82 ~~~~~~~~~~~~~~~~~i~~R~~~~~G~S~~~~ng~~V~~~~L~e~~~~l~~l~GQ~~~q~L~~~~~qr~lLD~FA~~~~ 161 (605) T TIGR00634 82 TALQEIELEEEDEDEEVILRRSISRDGRSRAYLNGKLVSASSLEELTSELLDLHGQHDQQLLLRPDEQRQLLDTFAGANL 161 (605) T ss_pred CHHHCCCCCCCCCCCEEEEEEEECCCCCCEEEECCCCCCHHHHHHHHHHHHHHHCCCHHHHCCCHHHHHHHHHHHHCCCH T ss_conf 03333788889897368766431257884678888215689999999874433234235320585578999988608655 Q ss_pred -HHHHHHHHHHHHHHHHHHHHHHHHH-HHHHHHHHHHHHHHHHCCCHHHHHHH-HHHHHHHHHHHHCCCCCCCCCHHHHH Q ss_conf -1389999999999999988877665-55543344443321100000234433-46777888986200012321023455 Q gi|255764514|r 153 -LSLCELGTLYRHWCCTADALKKYQE-QKSSSQDVEFLRFSIDELQALAVQPG-EENELVVMRSKILKQERIAVELSSIM 229 (554) Q Consensus 153 -~~~~~~~~~~~~~~~~~~~l~~l~~-~~~~~~e~e~l~~ql~El~~~~l~~~-E~e~L~~~~~~l~~~e~l~~~l~~~~ 229 (554) ..+..|+..|+.|...+..|..+.. ..+..+++|+|+|+++||+.+++.++ ||++|..+..+|++.+++.+...... T Consensus 162 ~~~~~~~~~~Y~~~~~~~~~L~~~~~~~~e~~~~~d~L~F~l~El~~~~l~~~dE~~~L~~e~~~Ls~~e~l~~~~~~a~ 241 (605) T TIGR00634 162 LEKVKAYRELYQAWLKARQQLKELQQKEQELAQRLDFLQFQLEELEEADLQPGDEDEALEAEQQRLSNLEKLRELSQNAL 241 (605) T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHCCHHHHHHHHHHHH T ss_conf 89999999999999999999999999999999999899998855420369988268999999998301789999999999 Q ss_pred HHHHC----CC----CHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHCCCHHHHHHHHHH Q ss_conf 53200----10----01799999998654310011001366764222100107999999987530001487640123566 Q gi|255764514|r 230 DDFHK----SS----SPISVISSMLRRLERKSTEVPDLLQKSISFLNEAQENLSDAQHEIERSFSEIQYDAQELANIEER 301 (554) Q Consensus 230 ~~l~~----~~----~~l~~l~~~~~~l~~~~~~~~~~l~~~~~~l~~~~~~l~e~~~el~~~~~~le~~~~~L~~ie~R 301 (554) ..+.+ .. ..+..+......+.+. ..++..+....+.+.+++.++.|+..++..|.+++++||++|+.++.| T Consensus 242 ~~L~~a~~~~d~~~~~~~~~~~~~~~~l~~~-~~~d~~l~~~~e~v~~al~~v~ea~~~l~~~~del~~Dp~~L~~i~~R 320 (605) T TIGR00634 242 AALRGALSDVDVQEGALLEGLGEAQLALASE-ESIDGSLRELAEQVENALTEVEEATRELREYLDELEFDPERLNEIEER 320 (605) T ss_pred HHHHHCCCCCCCCHHHHHHHHHHHHHHHHHH-CCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHH T ss_conf 9996215667554047999999999867775-088975899999999999999999999997377867696889999999 Q ss_pred HHHHHHHHHHHCCCHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH Q ss_conf 67888878762011156888752000026664433457777788888767652111366789999999888999997666 Q gi|255764514|r 302 LFALRAMSRKYSVSIDQLPELAKKMEEDLADISEGNEKVVSLERVLYEARQAYDRVAQDISTKRYQFAKMLEKNVMAEMP 381 (554) Q Consensus 302 l~~l~~L~rK~~~~~eel~~~~~~l~~~l~~l~~~~~~l~~l~~~~~~~~~~l~~~a~~Ls~~R~~~a~~L~~~i~~~L~ 381 (554) +..|.+|+|||+.+++++.++.+++++++++|.+.+...+.|++++..+.+++...|..||..|++.|++|++.|..+|+ T Consensus 321 l~~~~~L~rKY~~~~~~~l~~~~~~~~El~~L~~~~~~~~~L~~~~~~l~~~~~~~A~~ls~~R~~~A~~L~~~v~~~Lk 400 (605) T TIGR00634 321 LAEIKRLKRKYGASVEEVLEYAEKIKEELDQLDDSDESLEALEEEVDKLEEELAKAAEALSLIRRKAAERLAKRVEQELK 400 (605) T ss_pred HHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH T ss_conf 99999998752689889999999999999866554347999999999999999999999869999999999999999975 Q ss_pred HHCCCCCEEEEEEECCCC-------------------CCCCCCCCCCEEEEECCCCCCCCHHHHHHCCHHHHHHHHHHHH Q ss_conf 520256337865202532-------------------2344654320011012789983113544062157999999999 Q gi|255764514|r 382 ALKLENVCFTVNITSDKE-------------------DISPDGIDRVEFYVQTNRGENPGPLMKLASGGELSRFLLALKI 442 (554) Q Consensus 382 ~L~m~~a~f~i~~~~~~~-------------------~~~~~G~d~v~f~~s~n~g~~~~pl~kiaSGGE~Sr~~LAl~~ 442 (554) .|+|+++.|.|+|..... ..+++|.|.|+|+||||.|+|++||+|+|||||+|||||||++ T Consensus 401 ~L~Me~a~F~v~~~~~~~~~~~~~~~~a~~L~~g~~~r~~~~G~D~V~F~fs~n~G~~~~PLak~ASGGELSRv~LAL~~ 480 (605) T TIGR00634 401 ALAMEKAEFTVELKTSLPSRNDEAPSVALALVSGAKARAGAYGADQVEFLFSANTGEPVKPLAKVASGGELSRVMLALKV 480 (605) T ss_pred HCCCCCEEEEEEEEECCCCCCCCCCCEEEEECCCCEEECCCCCCCEEEEEEECCCCCCCCCHHHHCCCCHHHHHHHHHHH T ss_conf 10212137899885235322235774056624785020265674315786413787898753544366169999999998 Q ss_pred HHCCC--CCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCEEEEECHHHHHHHCCCEEEEEEEEC------------- Q ss_conf 84366--899769980344688879999999999997305939998083798650176179999621------------- Q gi|255764514|r 443 VLVDQ--GSIPTLVFDEVDSGIGGAVADAIGYRLKQLSKKIQLLAVTHAPQVAARADRHFLVYKTNK------------- 507 (554) Q Consensus 443 ~~~~~--~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~~~Qvi~ITH~pqvAa~a~~h~~v~K~~~------------- 507 (554) +|+.. .+++||||||||+||||+||..||++|++||+++|||||||+|||||+||.||.|.|... T Consensus 481 ~ls~~~~~~~~TliFDEvDvGvsG~~A~~ia~~L~~LS~~~QV~cvTHlp~vAA~AD~h~~v~K~~~neniadPtnPqld 560 (605) T TIGR00634 481 VLSSSDPAAVTTLIFDEVDVGVSGKTAQAIAKKLAQLSERKQVLCVTHLPQVAAHADAHLKVEKELLNENIADPTNPQLD 560 (605) T ss_pred HCCCCCCCCCCCEEEEEEECCCCHHHHHHHHHHHHHHHHHCCEEEECCCHHHHHHCCCCEEEEEEEECCCCCCCCCCCCC T ss_conf 54234656787127631641764689999999999985309589981837989724881467754200114677887667 Q ss_pred -CCCCCEEEEEEEECCHH-HHHHHHHHHHCCCCCHHHHHHHHHHHHHC Q ss_conf -68752589999975988-99999999866880028999999988735 Q gi|255764514|r 508 -PDDTQRIETYVAVLTPQ-ERREEIARMLAGSHITEEARAAAEILLEF 553 (554) Q Consensus 508 -~~~~~~~~~~i~~l~~~-~r~~Eiarml~g~~~~~~~~~~A~~ll~~ 553 (554) ++ +|.|.|+.|+.+ +||.||||||||...|+.|++||++||+. T Consensus 561 eD~---~T~~~v~~L~~~G~rV~ElARllaG~~~s~~~la~A~ELL~~ 605 (605) T TIGR00634 561 EDG---RTATRVRPLSSEGERVAELARLLAGLEKSDLALAHAQELLEA 605 (605) T ss_pred CCC---CCCCEEECHHCCCCHHHHHHHHHCCCCHHHHHHHHHHHHHCC T ss_conf 878---862002200002636899999725760148889999987409 No 4 >cd03241 ABC_RecN RecN ATPase involved in DNA repair; ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds including sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins. Probab=100.00 E-value=0 Score=675.53 Aligned_cols=276 Identities=49% Similarity=0.770 Sum_probs=267.9 Q ss_pred CCEEEEECCEEEEEEEEECCCCEEEEECCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCEEEEEEEEECCCCHHHHHHHH Q ss_conf 92599942278999988738981899889997888999999987147325331128972589999997289737888887 Q gi|255764514|r 1 MTRLSIYNIVLIESLDIDFSAGLSILSGDTGSGKSILLDALILVTGGRGDGGLVRRHAEKGQVVAVFEISHLPALEILFA 80 (554) Q Consensus 1 L~~L~i~Nf~~i~~~~i~f~~Gl~vItGetGaGKS~ildAl~~~lG~r~~~~~Ir~g~~~a~Ve~~F~~~~~~~~~~~~~ 80 (554) |.+|+|+||++|++++|+|++||||||||||||||+|+|||.++||+|+++++||+|+++|.|+++|++++.+....|+. T Consensus 1 L~~L~IkNfalId~l~l~F~~GlnVlTGETGAGKSIlidAL~lllG~Ra~~~~IR~g~~~a~vea~F~i~~~~~~~~~l~ 80 (276) T cd03241 1 LLELSIKNFALIEELELDFEEGLTVLTGETGAGKSILLDALSLLLGGRASADLIRSGAEKAVVEGVFDISDEEEAKALLL 80 (276) T ss_pred CCEEEEEEEEEEEEEEEECCCCCEEEECCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCEEEEEEEEECCCCHHHHHHHH T ss_conf 96899960898988798259997588789988899999999996289988453358885089999997599668899997 Q ss_pred HCCCCCCCCEEEEEEEECCCCEEEEECCEEEECHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHCCHHHHHHHHH Q ss_conf 47898888389999994389779999998841011222111000001220000000036787777663000013899999 Q gi|255764514|r 81 EANLTLEKHVILRRVQFPDGRTKAYVNDQVVSVNFMRAVGSLLIEIHSQHADRSLLDVQGHRKILDSYADIDLSLCELGT 160 (554) Q Consensus 81 ~~~~~~~~~~iirR~i~~~GkS~~~INg~~v~~~~L~~l~~~lidi~gQ~e~~~Ll~~~~q~~lLD~~~~~~~~~~~~~~ 160 (554) +.+++.++++++||+|.++|||+|||||+|||++.|++++..||||||||++|.|+++++|+.+||. T Consensus 81 ~~~~~~d~~liirR~i~~~GrSr~~INg~~vt~~~L~~l~~~LidIHgQhe~q~Ll~~~~h~~lLD~------------- 147 (276) T cd03241 81 ELGIEDDDDLIIRREISRKGRSRYFINGQSVTLKLLRELGSLLVDIHGQHDHQNLLNPERQLDLLDG------------- 147 (276) T ss_pred HCCCCCCCCEEEEEEECCCCCCEEEECCEECCHHHHHHHHHHEEEECCCCCCHHHCCHHHHHHHHCC------------- T ss_conf 3799778844999998689970699999983799999997400899079610555498679998769------------- Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHCCCCHHH Q ss_conf 99999999988877665555433444433211000002344334677788898620001232102345553200100179 Q gi|255764514|r 161 LYRHWCCTADALKKYQEQKSSSQDVEFLRFSIDELQALAVQPGEENELVVMRSKILKQERIAVELSSIMDDFHKSSSPIS 240 (554) Q Consensus 161 ~~~~~~~~~~~l~~l~~~~~~~~e~e~l~~ql~El~~~~l~~~E~e~L~~~~~~l~~~e~l~~~l~~~~~~l~~~~~~l~ 240 (554) T Consensus 148 -------------------------------------------------------------------------------- 147 (276) T cd03241 148 -------------------------------------------------------------------------------- 147 (276) T ss_pred -------------------------------------------------------------------------------- T ss_conf -------------------------------------------------------------------------------- Q ss_pred HHHHHHHHHHHHHCCCCHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHCCCHHHHH Q ss_conf 99999986543100110013667642221001079999999875300014876401235666788887876201115688 Q gi|255764514|r 241 VISSMLRRLERKSTEVPDLLQKSISFLNEAQENLSDAQHEIERSFSEIQYDAQELANIEERLFALRAMSRKYSVSIDQLP 320 (554) Q Consensus 241 ~l~~~~~~l~~~~~~~~~~l~~~~~~l~~~~~~l~e~~~el~~~~~~le~~~~~L~~ie~Rl~~l~~L~rK~~~~~eel~ 320 (554) T Consensus 148 -------------------------------------------------------------------------------- 147 (276) T cd03241 148 -------------------------------------------------------------------------------- 147 (276) T ss_pred -------------------------------------------------------------------------------- T ss_conf -------------------------------------------------------------------------------- Q ss_pred HHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEEEECCCCC Q ss_conf 87520000266644334577777888887676521113667899999998889999976665202563378652025322 Q gi|255764514|r 321 ELAKKMEEDLADISEGNEKVVSLERVLYEARQAYDRVAQDISTKRYQFAKMLEKNVMAEMPALKLENVCFTVNITSDKED 400 (554) Q Consensus 321 ~~~~~l~~~l~~l~~~~~~l~~l~~~~~~~~~~l~~~a~~Ls~~R~~~a~~L~~~i~~~L~~L~m~~a~f~i~~~~~~~~ 400 (554) T Consensus 148 -------------------------------------------------------------------------------- 147 (276) T cd03241 148 -------------------------------------------------------------------------------- 147 (276) T ss_pred -------------------------------------------------------------------------------- T ss_conf -------------------------------------------------------------------------------- Q ss_pred CCCCCCCCCEEEEECCCCCCCCHHHHHHCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHC Q ss_conf 34465432001101278998311354406215799999999984366899769980344688879999999999997305 Q gi|255764514|r 401 ISPDGIDRVEFYVQTNRGENPGPLMKLASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSKK 480 (554) Q Consensus 401 ~~~~G~d~v~f~~s~n~g~~~~pl~kiaSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~~ 480 (554) |.|.++|++++|||++++|+.|+|||||+||+||||+.+++..++.||+||||||+||||++|..||++|++||++ T Consensus 148 ----~~d~ief~~~~~~g~~~~~l~~~aSgGElSRi~LAlk~~~~~~~~~~tliFDEID~GigG~~A~~vg~~l~~ls~~ 223 (276) T cd03241 148 ----GLDDVEFLFSTNPGEPLKPLAKIASGGELSRLMLALKAILARKDAVPTLIFDEIDTGISGEVAQAVGKKLKELSRS 223 (276) T ss_pred ----CCCCHHHHCCCCCCCCCCHHHHHHCHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHCC T ss_conf ----8610021215998997524676627648999999999996278899857984457898989999999999998479 Q ss_pred CCEEEEECHHHHHHHCCCEEEEEEEECCCCCCEEEEEEEECCHHHHHHHHHHHHCC Q ss_conf 93999808379865017617999962168752589999975988999999998668 Q gi|255764514|r 481 IQLLAVTHAPQVAARADRHFLVYKTNKPDDTQRIETYVAVLTPQERREEIARMLAG 536 (554) Q Consensus 481 ~Qvi~ITH~pqvAa~a~~h~~v~K~~~~~~~~~~~~~i~~l~~~~r~~Eiarml~g 536 (554) +|||||||||||||+||+||+|+|...++ +|+|.|+.|+.++|++|||||||| T Consensus 224 ~QVi~ITHlpQvAa~ad~H~~V~K~~~~~---~t~t~i~~L~~~eRv~EiARMl~G 276 (276) T cd03241 224 HQVLCITHLPQVAAMADNHFLVEKEVEGG---RTVTKVRELDKEERVEEIARMLSG 276 (276) T ss_pred CEEEEEECHHHHHHCCCCEEEEEEEECCC---EEEEEEEECCHHHHHHHHHHHHCC T ss_conf 87999817799884137679999980499---289999999860899999997289 No 5 >TIGR02168 SMC_prok_B chromosome segregation protein SMC; InterPro: IPR011890 The SMC (structural maintenance of chromosomes) family of proteins, exist in virtually all organisms including both bacteria and archaea. The SMC proteins are essential for successful chromosome transmission during replication and segregation of the genome in all organisms and form three types of heterodimer (SMC1SMC3, SMC2SMC4, SMC5SMC6), which are core components of large multiprotein complexes. The best known complexes are cohesin, which is responsible for sister-chromatid cohesion, and condensin, which is required for full chromosome condensation in mitosis. SMCs are generally present as single proteins in bacteria, and as at least six distinct proteins in eukaryotes. The proteins range in size from approximately 110 to 170 kDa, and share a five-domain structure, with globular N- and C-terminal (IPR003395 from INTERPRO) domains separated by a long (circa 100 nm or 900 residues) coiled coil segment in the centre of which is a globular ''hinge'' domain, characterised by a set of four highly conserved glycine residues that are typical of flexible regions in a protein. The amino-terminal domain contains a 'Walker A' nucleotide-binding domain (GxxGxGKS/T), which by mutational studies has been shown to be essential in several proteins. The carboxy-terminal domain contains a sequence (the DA-box) that resembles a 'Walker B' motif (XXXXD, where X is any hydrophobic residue), and a LSGG motif with homology to the signature sequence of the ATP-binding cassette (ABC) family of ATPases . All SMC proteins appear to form dimers, either forming homodimers with themselves, as in the case of prokaryotic SMC proteins, or heterodimers between different but related SMC proteins. The dimers are arranged in an antiparallel alignment. This orientation brings the N- and C-terminal globular domains (from either different or identical protamers) together, which unites an ATP binding site (Walker A motif) within the N-terminal domain with a Walker B motif (DA box) within the C-terminal domain, to form a potentially functional ATPase. Protein interaction and microscopy data suggest that SMC dimers form a ring-like structure which might embrace DNA molecules. Non-SMC subunits associate with the SMC amino- and carboxy-terminal domains. The sequence homology within the carboxy-terminal domain is relatively high within the SMC1-SMC4 group, whereas SMC5 and SMC6 show some divergence in both of these sequences. SMCs share not only sequence similarity but also structural similarity with ABC proteins. SMC proteins function together with other proteins in a range of chromosomal transactions, including chromosome condensation, sister-chromatid cohesion, recombination, DNA repair and epigenetic silencing of gene expression . The smc gene is often associated with scpB (IPR005234 from INTERPRO) and scpA genes, where scp stands for segregation and condensation protein. SMC was shown (in Caulobacter crescentus) to be induced early in S phase but present and bound to DNA throughout the cell cycle , , .; GO: 0005515 protein binding, 0005524 ATP binding, 0005694 chromosome. Probab=100.00 E-value=0 Score=419.31 Aligned_cols=130 Identities=27% Similarity=0.343 Sum_probs=116.3 Q ss_pred HHHHHHHHHC---CCCCEEEEEEECCCCCCCCCCCCCCEEEEECCCCCCCCHHHHHHCCHHHHHHHHHHHHHHCCCCCCC Q ss_conf 9997666520---2563378652025322344654320011012789983113544062157999999999843668997 Q gi|255764514|r 375 NVMAEMPALK---LENVCFTVNITSDKEDISPDGIDRVEFYVQTNRGENPGPLMKLASGGELSRFLLALKIVLVDQGSIP 451 (554) Q Consensus 375 ~i~~~L~~L~---m~~a~f~i~~~~~~~~~~~~G~d~v~f~~s~n~g~~~~pl~kiaSGGE~Sr~~LAl~~~~~~~~~~p 451 (554) .|++.|+.+- |.||...+.++ +++++-..| |++.++| ||+++++|+ ++||||+|.|++||.|++...+|+| T Consensus 1052 ~vn~~F~~~F~~LFgGG~A~L~LT-d~~d~LeaG---ieI~A~P-PGKk~~~l~-LLSGGEKALTA~ALlFAIf~~~P~P 1125 (1191) T TIGR02168 1052 QVNENFQRVFPKLFGGGEAELRLT-DPEDLLEAG---IEIMAQP-PGKKNQNLS-LLSGGEKALTALALLFAIFKVKPAP 1125 (1191) T ss_pred HHHHHHHHHHHHHCCCCEEEEEEE-CCCCCCCCC---CEEEEEC-CCCCCCCCC-CCCCHHHHHHHHHHHHHHHCCCCCC T ss_conf 999888668586489987898865-687743377---5678527-639876643-0201579999999999996007887 Q ss_pred EEEEECCCCCCCHHHHHHHHHHHHHHHHCCCEEEEECHHHHHHHCCCEEEEEEEECCCCC Q ss_conf 699803446888799999999999973059399980837986501761799996216875 Q gi|255764514|r 452 TLVFDEVDSGIGGAVADAIGYRLKQLSKKIQLLAVTHAPQVAARADRHFLVYKTNKPDDT 511 (554) Q Consensus 452 ~~ifDEiDagi~G~~a~~v~~~l~~ls~~~Qvi~ITH~pqvAa~a~~h~~v~K~~~~~~~ 511 (554) |||||||||-++-.|..+++++||++|+++|||+|||-+-.=+.||.=|-|.=.. .|.| T Consensus 1126 FC~LDEVDAPLDdaNV~RF~~ll~~~~~~tQFI~iTHnk~TM~~AD~L~GVTM~e-~GVS 1184 (1191) T TIGR02168 1126 FCILDEVDAPLDDANVERFANLLKEMSKKTQFIVITHNKGTMEVADQLYGVTMQE-KGVS 1184 (1191) T ss_pred EEEECCCCCCCCHHHHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHHCCEEECC-CCCC T ss_conf 2632123367982669999999999851892788867848999862033621016-8802 No 6 >TIGR02169 SMC_prok_A chromosome segregation protein SMC; InterPro: IPR011891 The SMC (structural maintenance of chromosomes) family of proteins, exist in virtually all organisms including both bacteria and archaea. The SMC proteins are essential for successful chromosome transmission during replication and segregation of the genome in all organisms and form three types of heterodimer (SMC1SMC3, SMC2SMC4, SMC5SMC6), which are core components of large multiprotein complexes. The best known complexes are cohesin, which is responsible for sister-chromatid cohesion, and condensin, which is required for full chromosome condensation in mitosis. SMCs are generally present as single proteins in bacteria, and as at least six distinct proteins in eukaryotes. The proteins range in size from approximately 110 to 170 kDa, and share a five-domain structure, with globular N- and C-terminal (IPR003395 from INTERPRO) domains separated by a long (circa 100 nm or 900 residues) coiled coil segment in the centre of which is a globular ''hinge'' domain, characterised by a set of four highly conserved glycine residues that are typical of flexible regions in a protein. The amino-terminal domain contains a 'Walker A' nucleotide-binding domain (GxxGxGKS/T), which by mutational studies has been shown to be essential in several proteins. The carboxy-terminal domain contains a sequence (the DA-box) that resembles a 'Walker B' motif (XXXXD, where X is any hydrophobic residue), and a LSGG motif with homology to the signature sequence of the ATP-binding cassette (ABC) family of ATPases . All SMC proteins appear to form dimers, either forming homodimers with themselves, as in the case of prokaryotic SMC proteins, or heterodimers between different but related SMC proteins. The dimers are arranged in an antiparallel alignment. This orientation brings the N- and C-terminal globular domains (from either different or identical protamers) together, which unites an ATP binding site (Walker A motif) within the N-terminal domain with a Walker B motif (DA box) within the C-terminal domain, to form a potentially functional ATPase. Protein interaction and microscopy data suggest that SMC dimers form a ring-like structure which might embrace DNA molecules. Non-SMC subunits associate with the SMC amino- and carboxy-terminal domains. The sequence homology within the carboxy-terminal domain is relatively high within the SMC1-SMC4 group, whereas SMC5 and SMC6 show some divergence in both of these sequences. SMCs share not only sequence similarity but also structural similarity with ABC proteins. SMC proteins function together with other proteins in a range of chromosomal transactions, including chromosome condensation, sister-chromatid cohesion, recombination, DNA repair and epigenetic silencing of gene expression . This family represents the SMC protein of archaea and a few bacteria (Aquifex, Synechocystis, etc); the SMC of other bacteria is described by IPR011890 from INTERPRO. The N- and C-terminal domains of this protein are well conserved, but the central hinge region is skewed in composition and highly divergent .. Probab=100.00 E-value=0 Score=409.41 Aligned_cols=174 Identities=20% Similarity=0.246 Sum_probs=133.7 Q ss_pred CCEEEEECCEEEE--EEEEECCCCEEEEECCCCCCHHHHHHHHHHHHCCCCC--------CCCCCCC----------CCE Q ss_conf 9259994227899--9988738981899889997888999999987147325--------3311289----------725 Q gi|255764514|r 1 MTRLSIYNIVLIE--SLDIDFSAGLSILSGDTGSGKSILLDALILVTGGRGD--------GGLVRRH----------AEK 60 (554) Q Consensus 1 L~~L~i~Nf~~i~--~~~i~f~~Gl~vItGetGaGKS~ildAl~~~lG~r~~--------~~~Ir~g----------~~~ 60 (554) |++|.++||.+|. ...|+|.+|||||+||||||||||+|||.||||..++ +|||.+| .+. T Consensus 2 Ie~ie~~nFKSFg~kk~~Ipf~~GFtvIsGPNGSGKSNI~DaiLFaLGl~s~k~~RAe~LsDLi~~gahe~~~~~~~~~e 81 (1202) T TIGR02169 2 IEKIELENFKSFGTKKKVIPFLKGFTVISGPNGSGKSNIIDAILFALGLSSSKAMRAERLSDLIFNGAHEAAKNAKSADE 81 (1202) T ss_pred CEEEEEECCEEECCCEEEEECCCCCEEEECCCCCCHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCE T ss_conf 25788720112078712631688884788888886455999999976641023422210522244874222356889968 Q ss_pred EEEEEEEECCCCHHH-----HHHHHHCCCCCCCC-EEEEEEEECCCC--EEEEECCEEEECHHHHHHHHH-HH-----CC Q ss_conf 899999972897378-----88887478988883-899999943897--799999988410112221110-00-----00 Q gi|255764514|r 61 GQVVAVFEISHLPAL-----EILFAEANLTLEKH-VILRRVQFPDGR--TKAYVNDQVVSVNFMRAVGSL-LI-----EI 126 (554) Q Consensus 61 a~Ve~~F~~~~~~~~-----~~~~~~~~~~~~~~-~iirR~i~~~Gk--S~~~INg~~v~~~~L~~l~~~-li-----di 126 (554) |.|+++|.+++.... .....++-...|+. +..|+.|+.+|+ |-||+||++|+++.|.+.... -| .| T Consensus 82 a~V~v~F~nd~~~~prsqvttaaGsenv~~vde~~v~Rr~kv~~~~~yySyY~lNG~~~~l~ei~d~L~~~gI~p~gYNv 161 (1202) T TIGR02169 82 AEVTVTFKNDDGKFPRSQVTTAAGSENVLEVDELEVSRRLKVTDDGKYYSYYYLNGKSVRLSEIHDFLAAAGIYPEGYNV 161 (1202) T ss_pred EEEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCEEEEEEEEECCCCCEEEEEEECCCCCCHHHHHHHHHHCCCCCCCCEE T ss_conf 98988872278758731000022444444224358998888737984688888708203576689999861768898706 Q ss_pred CCCCCHHHH--HHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHH Q ss_conf 122000000--003678777766300001389999999999999988877 Q gi|255764514|r 127 HSQHADRSL--LDVQGHRKILDSYADIDLSLCELGTLYRHWCCTADALKK 174 (554) Q Consensus 127 ~gQ~e~~~L--l~~~~q~~lLD~~~~~~~~~~~~~~~~~~~~~~~~~l~~ 174 (554) .=|+|--.+ |+|..+|.|+|..+|+.+.-.+...+..++......+++ T Consensus 162 VlQGDvt~~I~Ms~~ERRkiIdeiAGvaeFD~kkekA~eeL~~V~~~~~~ 211 (1202) T TIGR02169 162 VLQGDVTKIISMSAVERRKIIDEIAGVAEFDRKKEKALEELEEVEERIER 211 (1202) T ss_pred EEECCHHHHCCCCHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHH T ss_conf 74354123103884356788888548148889999999999999999999 No 7 >pfam02463 SMC_N RecF/RecN/SMC N terminal domain. This domain is found at the N terminus of SMC proteins. The SMC (structural maintenance of chromosomes) superfamily proteins have ATP-binding domains at the N- and C-termini, and two extended coiled-coil domains separated by a hinge in the middle. The eukaryotic SMC proteins form two kind of heterodimers: the SMC1/SMC3 and the SMC2/SMC4 types. These heterodimers constitute an essential part of higher order complexes, which are involved in chromatin and DNA dynamics. This family also includes the RecF and RecN proteins that are involved in DNA metabolism and recombination. Probab=100.00 E-value=0 Score=391.33 Aligned_cols=118 Identities=23% Similarity=0.313 Sum_probs=107.1 Q ss_pred CCCCEEEEEEECCCCCCCCCCCCCCEEEEECCCCCCCCHHHHHHCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCH Q ss_conf 25633786520253223446543200110127899831135440621579999999998436689976998034468887 Q gi|255764514|r 385 LENVCFTVNITSDKEDISPDGIDRVEFYVQTNRGENPGPLMKLASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGG 464 (554) Q Consensus 385 m~~a~f~i~~~~~~~~~~~~G~d~v~f~~s~n~g~~~~pl~kiaSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G 464 (554) ++||...+.+.. +++|...| |+|.+.| ||+++++|+ .+||||+|.++|||.||+..++|+||||||||||.++. T Consensus 1042 ~~gG~a~L~l~~-~~d~~~~G---i~i~~~p-pgK~~~~l~-~LSGGEKtL~ALaLlFAi~~~~PaPFyiLDEIDAaLD~ 1115 (1162) T pfam02463 1042 ELGGSAELRLED-SDDPFSGG---IEISARP-PGKGVKNLD-NLSGGEKTLVALALIFAIQKYRPAPFYLLDEIDAALDD 1115 (1162) T ss_pred CCCCEEEEECCC-CCCCCCCC---EEEEEEC-CCCCCCCHH-HHCHHHHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCH T ss_conf 799537885079-99984889---6899989-489688968-84878899999999999986289837875486636669 Q ss_pred HHHHHHHHHHHHHHHCCCEEEEECHHHHHHHCCCEEEEEEEECC Q ss_conf 99999999999973059399980837986501761799996216 Q gi|255764514|r 465 AVADAIGYRLKQLSKKIQLLAVTHAPQVAARADRHFLVYKTNKP 508 (554) Q Consensus 465 ~~a~~v~~~l~~ls~~~Qvi~ITH~pqvAa~a~~h~~v~K~~~~ 508 (554) .+..+||.+|+++|+++|||||||-|.+=..||.-|-|++...+ T Consensus 1116 ~Nv~~ia~~ik~~s~~sQFIvIS~r~~~~~~Ad~L~GVtm~e~G 1159 (1162) T pfam02463 1116 QNVSRVANYLKELSKNAQFIVISLREEMLEKADRLVGVYMVENG 1159 (1162) T ss_pred HHHHHHHHHHHHCCCCCEEEEEEECHHHHHHHHHEEEEEECCCC T ss_conf 99999999999749999899986078999872375887878999 No 8 >COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning] Probab=100.00 E-value=0 Score=373.55 Aligned_cols=120 Identities=28% Similarity=0.351 Sum_probs=107.2 Q ss_pred CCCCEEEEEEECCCCCCCCCCCCCCEEEEECCCCCCCCHHHHHHCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCH Q ss_conf 25633786520253223446543200110127899831135440621579999999998436689976998034468887 Q gi|255764514|r 385 LENVCFTVNITSDKEDISPDGIDRVEFYVQTNRGENPGPLMKLASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGG 464 (554) Q Consensus 385 m~~a~f~i~~~~~~~~~~~~G~d~v~f~~s~n~g~~~~pl~kiaSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G 464 (554) ++||...+.+... ++|...| |+|.++| ||+++++++ .+||||+|.++|||.|++..+.|+||||||||||+++. T Consensus 1030 ~~GG~a~L~l~~~-dd~l~~G---iei~a~p-pgK~~~~l~-~LSGGEKsLtAlAllFAi~~~~PaPf~vLDEVDAaLD~ 1103 (1163) T COG1196 1030 FGGGTAELELTEP-DDPLTAG---IEISARP-PGKKLQSLS-LLSGGEKSLTALALLFAIQKYRPAPFYVLDEVDAALDD 1103 (1163) T ss_pred CCCCEEEEEECCC-CCHHHCC---CEEEEEC-CCCCCCCCC-CCCCCHHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCH T ss_conf 7996289986899-8623259---5899738-998656212-14861899999999999971379986886245435668 Q ss_pred HHHHHHHHHHHHHHHCCCEEEEECHHHHHHHCCCEEEEEEEECCCCC Q ss_conf 99999999999973059399980837986501761799996216875 Q gi|255764514|r 465 AVADAIGYRLKQLSKKIQLLAVTHAPQVAARADRHFLVYKTNKPDDT 511 (554) Q Consensus 465 ~~a~~v~~~l~~ls~~~Qvi~ITH~pqvAa~a~~h~~v~K~~~~~~~ 511 (554) .+..+|+++|+++|+++|||||||.|.+=..||.=|.|.-... |.+ T Consensus 1104 ~Nv~r~~~~i~e~s~~sQFIvIThr~~~m~~ad~l~GVtm~~~-GvS 1149 (1163) T COG1196 1104 ANVERVARLIKEMSKETQFIVITHRKGTMEAADRLVGVTMQEK-GVS 1149 (1163) T ss_pred HHHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHEEEEEEECC-CCC T ss_conf 9999999999981789828999777488887777014899649-976 No 9 >PRK02224 chromosome segregation protein; Provisional Probab=100.00 E-value=1.2e-43 Score=306.55 Aligned_cols=97 Identities=24% Similarity=0.296 Sum_probs=84.4 Q ss_pred CEEEEECCCCCCCCHHHHHHCCHHHHHHHHHHHHHHCCC--------CCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHC Q ss_conf 001101278998311354406215799999999984366--------899769980344688879999999999997305 Q gi|255764514|r 409 VEFYVQTNRGENPGPLMKLASGGELSRFLLALKIVLVDQ--------GSIPTLVFDEVDSGIGGAVADAIGYRLKQLSKK 480 (554) Q Consensus 409 v~f~~s~n~g~~~~pl~kiaSGGE~Sr~~LAl~~~~~~~--------~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~~ 480 (554) .++.+.++.|.+ .|+ +.+||||.++++|||.+++++. .|.|||||||++++++.....+++.+|..++.. T Consensus 765 ~~~~v~~~~g~~-~~~-~~LSGGE~~~~aLaLrlAl~~~l~~~~~g~~~~~~lilDE~~~~LD~~~~~~l~~~l~~l~~~ 842 (880) T PRK02224 765 YELTVYQKDGTP-LEP-KQLSGGERALFNLSLRCAIYRLLAEGIGGDAPLPPLILDEPTVFLDSGHVSQLVKLIEMMRRI 842 (880) T ss_pred CEEEEECCCCEE-CCC-CCCCHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCEEEECCCCCCCHHHHHHHHHHHHHHHCC T ss_conf 038997799805-368-888878999999999999999998733788889807885999887988999999999998728 Q ss_pred --CCEEEEECHHHHHHHCCCEEEEEEEEC Q ss_conf --939998083798650176179999621 Q gi|255764514|r 481 --IQLLAVTHAPQVAARADRHFLVYKTNK 507 (554) Q Consensus 481 --~Qvi~ITH~pqvAa~a~~h~~v~K~~~ 507 (554) .|||||||-|....++|+-|.|.|... T Consensus 843 ~~~qiiiITH~~el~~~~d~~i~V~K~~~ 871 (880) T PRK02224 843 GVEQIIVVSHDDELIAAADHVVQVEKDPT 871 (880) T ss_pred CCCEEEEEECHHHHHHHCCEEEEEEECCC T ss_conf 99989999554889986896899998799 No 10 >PRK01156 chromosome segregation protein; Provisional Probab=100.00 E-value=2.9e-39 Score=277.82 Aligned_cols=90 Identities=20% Similarity=0.245 Sum_probs=78.4 Q ss_pred CCCCCCCHHHHHHCCHHHHHHHHHHHHHHCCC--CCCCEEEEECCCCCCCHHHHHHHHHHHHH----HHHCCCEEEEECH Q ss_conf 78998311354406215799999999984366--89976998034468887999999999999----7305939998083 Q gi|255764514|r 416 NRGENPGPLMKLASGGELSRFLLALKIVLVDQ--GSIPTLVFDEVDSGIGGAVADAIGYRLKQ----LSKKIQLLAVTHA 489 (554) Q Consensus 416 n~g~~~~pl~kiaSGGE~Sr~~LAl~~~~~~~--~~~p~~ifDEiDagi~G~~a~~v~~~l~~----ls~~~Qvi~ITH~ 489 (554) .+|..++|+. .+||||.+.++|||.++++.. .|.|||||||+++.++......+...|.. .+...|||+|||- T Consensus 791 ~~~g~~r~v~-~LSGGE~~~~aLaL~laL~~~~~~~~~~~ilDE~~~~LD~~~~~~l~~~l~~~~~~~~~~~qi~IISH~ 869 (895) T PRK01156 791 SRGGMVEGID-SLSGGEKTAVAFALRVAVAQFLNNDKSLLIMDEPTAFLDEDRRTNLKDIIEYSLKDSSDIPQVIMISHH 869 (895) T ss_pred ECCCEECCCC-CCCHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHCCCCCEEEEEECH T ss_conf 2598254366-788779999999999999999845899599859987758778999999999998636898879998244 Q ss_pred HHHHHHCCCEEEEEEEE Q ss_conf 79865017617999962 Q gi|255764514|r 490 PQVAARADRHFLVYKTN 506 (554) Q Consensus 490 pqvAa~a~~h~~v~K~~ 506 (554) |.+-..+|+.|.|.|.. T Consensus 870 ~el~~~~d~~i~V~K~~ 886 (895) T PRK01156 870 RELLSVADVAYEVKKSS 886 (895) T ss_pred HHHHHHCCCEEEEEEEC T ss_conf 88998589379999988 No 11 >cd03275 ABC_SMC1_euk Eukaryotic SMC1 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains. Amino-acid sequence homology of SMC proteins between species is largely confined to the amino- and carboxy-terminal globular domains. The amino-terminal domain contains a 'Walker A' nucleotide-binding domain (GxxGxGKS/T, in the single-letter amino-acid code), which by mutational studies has been shown to be essential in several proteins. The carboxy-terminal domain contains a sequence (the DA-box) that resembles a 'Walker B' motif, and a motif with homology to the signature sequence of the ATP-binding cassette (ABC) family of ATPases. The sequence homology within the carboxy-terminal domain is relatively high within the SMC1-SMC4 group, whereas SMC5 and SMC6 show some divergence in both of these sequences. In eukaryotic cells, the proteins are found as heterodimers of SMC1 paired with SMC3, SMC2 with SMC4, and SMC5 with SMC6 (for Probab=100.00 E-value=2.2e-42 Score=298.36 Aligned_cols=217 Identities=23% Similarity=0.275 Sum_probs=178.7 Q ss_pred CCEEEEECCEEEE-EEEEECCCCEEEEECCCCCCHHHHHHHHHHHHCCCCC-------CCCCCCC------CCEEEEEEE Q ss_conf 9259994227899-9988738981899889997888999999987147325-------3311289------725899999 Q gi|255764514|r 1 MTRLSIYNIVLIE-SLDIDFSAGLSILSGDTGSGKSILLDALILVTGGRGD-------GGLVRRH------AEKGQVVAV 66 (554) Q Consensus 1 L~~L~i~Nf~~i~-~~~i~f~~Gl~vItGetGaGKS~ildAl~~~lG~r~~-------~~~Ir~g------~~~a~Ve~~ 66 (554) |++|.|.||.++. ...|.|.+|||+|+||||||||+|+|||+||||.++. .++|-.| ...|.|+++ T Consensus 1 lk~l~l~gFKSf~~~~~i~~~~~~t~IvGpNGsGKSNi~DAi~~vlGe~s~~lR~~~m~DlIf~g~~~~~~~~~A~V~l~ 80 (247) T cd03275 1 LKRLELENFKSYKGRHVIGPFDRFTCIIGPNGSGKSNLMDAISFVLGEKSSHLRSKNLKDLIYRARVGKPDSNSAYVTAV 80 (247) T ss_pred CCEEEECCCCCCCCCEEECCCCCCEEEECCCCCCHHHHHHHHHHHHCCCHHHHCCCCCCEEEECCCCCCCCCCEEEEEEE T ss_conf 94489807536789868548998379989987765888999999965662330645611278658878899854899999 Q ss_pred EECCCCHHHHHHHHHCCCCCCCCEEEEEEEECCCCEEEEECCEEEECHHHHHHHHHH-HC------CCCCCCHHHHHHHH Q ss_conf 972897378888874789888838999999438977999999884101122211100-00------01220000000036 Q gi|255764514|r 67 FEISHLPALEILFAEANLTLEKHVILRRVQFPDGRTKAYVNDQVVSVNFMRAVGSLL-IE------IHSQHADRSLLDVQ 139 (554) Q Consensus 67 F~~~~~~~~~~~~~~~~~~~~~~~iirR~i~~~GkS~~~INg~~v~~~~L~~l~~~l-id------i~gQ~e~~~Ll~~~ 139 (554) |+.++ +++.+.|.+.++|.|.|+|||++|++..+.++.... |. |.+|++--.+++.. T Consensus 81 f~n~~----------------~ev~i~Rr~~r~G~seY~INg~~vrlkdi~elf~~~gIgv~a~nflV~QG~Ve~Il~~~ 144 (247) T cd03275 81 YEDDD----------------GEEKTFRRIITGGSSSYRINGKVVSLKEYNEELEKINILVKARNFLVFQGDVESIASKN 144 (247) T ss_pred EECCC----------------CEEEEEEEEEECCCEEEEECCCCCCHHHHHHHHHHCCCCCCCCCEEEECCHHHHHHCCC T ss_conf 98899----------------85999999997885068788972678999999876599977872389644488886379 Q ss_pred HHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHCCCC Q ss_conf 78777766300001389999999999999988877665555433444433211000002344334677788898620001 Q gi|255764514|r 140 GHRKILDSYADIDLSLCELGTLYRHWCCTADALKKYQEQKSSSQDVEFLRFSIDELQALAVQPGEENELVVMRSKILKQE 219 (554) Q Consensus 140 ~q~~lLD~~~~~~~~~~~~~~~~~~~~~~~~~l~~l~~~~~~~~e~e~l~~ql~El~~~~l~~~E~e~L~~~~~~l~~~e 219 (554) . T Consensus 145 -------------P------------------------------------------------------------------ 145 (247) T cd03275 145 -------------P------------------------------------------------------------------ 145 (247) T ss_pred -------------C------------------------------------------------------------------ T ss_conf -------------3------------------------------------------------------------------ Q ss_pred CCCCCHHHHHHHHHCCCCHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHCCCHHHHHHHH Q ss_conf 23210234555320010017999999986543100110013667642221001079999999875300014876401235 Q gi|255764514|r 220 RIAVELSSIMDDFHKSSSPISVISSMLRRLERKSTEVPDLLQKSISFLNEAQENLSDAQHEIERSFSEIQYDAQELANIE 299 (554) Q Consensus 220 ~l~~~l~~~~~~l~~~~~~l~~l~~~~~~l~~~~~~~~~~l~~~~~~l~~~~~~l~e~~~el~~~~~~le~~~~~L~~ie 299 (554) T Consensus 146 -------------------------------------------------------------------------------- 145 (247) T cd03275 146 -------------------------------------------------------------------------------- 145 (247) T ss_pred -------------------------------------------------------------------------------- T ss_conf -------------------------------------------------------------------------------- Q ss_pred HHHHHHHHHHHHHCCCHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH Q ss_conf 66678888787620111568887520000266644334577777888887676521113667899999998889999976 Q gi|255764514|r 300 ERLFALRAMSRKYSVSIDQLPELAKKMEEDLADISEGNEKVVSLERVLYEARQAYDRVAQDISTKRYQFAKMLEKNVMAE 379 (554) Q Consensus 300 ~Rl~~l~~L~rK~~~~~eel~~~~~~l~~~l~~l~~~~~~l~~l~~~~~~~~~~l~~~a~~Ls~~R~~~a~~L~~~i~~~ 379 (554) T Consensus 146 -------------------------------------------------------------------------------- 145 (247) T cd03275 146 -------------------------------------------------------------------------------- 145 (247) T ss_pred -------------------------------------------------------------------------------- T ss_conf -------------------------------------------------------------------------------- Q ss_pred HHHHCCCCCEEEEEEECCCCCCCCCCCCCCEEEEECCCCCCCCHHHHHHCCHHHHHHHHHHHHHHCCCCCCCEEEEECCC Q ss_conf 66520256337865202532234465432001101278998311354406215799999999984366899769980344 Q gi|255764514|r 380 MPALKLENVCFTVNITSDKEDISPDGIDRVEFYVQTNRGENPGPLMKLASGGELSRFLLALKIVLVDQGSIPTLVFDEVD 459 (554) Q Consensus 380 L~~L~m~~a~f~i~~~~~~~~~~~~G~d~v~f~~s~n~g~~~~pl~kiaSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiD 459 (554) |+..++|+. .+||||+|+++|||.|++..+.|+||||||||| T Consensus 146 -------------------------------------p~rRf~~~~-~LSGGEKtl~alallFai~~~~PsPF~vLDEVD 187 (247) T cd03275 146 -------------------------------------PGKRFRDMD-NLSGGEKTMAALALLFAIHSYQPAPFFVLDEVD 187 (247) T ss_pred -------------------------------------HHHCCCCHH-HCCCCHHHHHHHHHHHHHHCCCCCCEEEEECCC T ss_conf -------------------------------------031002123-338208999999999999712899558870676 Q ss_pred CCCCHHHHHHHHHHHHHHH-HCCCEEEEECHHHHHHHCCCEEEEEEEECCCC Q ss_conf 6888799999999999973-05939998083798650176179999621687 Q gi|255764514|r 460 SGIGGAVADAIGYRLKQLS-KKIQLLAVTHAPQVAARADRHFLVYKTNKPDD 510 (554) Q Consensus 460 agi~G~~a~~v~~~l~~ls-~~~Qvi~ITH~pqvAa~a~~h~~v~K~~~~~~ 510 (554) |.++..++.+++++|++.+ +++|||||||-+.+-..||..|-|.++..++. T Consensus 188 AaLD~~Nv~r~~~~i~~~~~~~~QfIvITh~~~~~~~Ad~L~GVt~~~~~gv 239 (247) T cd03275 188 AALDNTNVGKVASYIREQAGPNFQFIVISLKEEFFSKADALVGVYRDQECNS 239 (247) T ss_pred CCCCHHHHHHHHHHHHHHHCCCCEEEEEECCHHHHHHCCEEEEEEECCCCCC T ss_conf 3468899999999999872568679999888899863001898996356881 No 12 >PRK03918 chromosome segregation protein; Provisional Probab=100.00 E-value=3.1e-37 Score=264.39 Aligned_cols=98 Identities=24% Similarity=0.287 Sum_probs=82.7 Q ss_pred CCCCCCCCHHHHHHCCHHHHHHHHHHHHHHCC--CCCCCEEEEECCCCCCCHHHHHHHHHHHHHHH-HCCCEEEEECHHH Q ss_conf 27899831135440621579999999998436--68997699803446888799999999999973-0593999808379 Q gi|255764514|r 415 TNRGENPGPLMKLASGGELSRFLLALKIVLVD--QGSIPTLVFDEVDSGIGGAVADAIGYRLKQLS-KKIQLLAVTHAPQ 491 (554) Q Consensus 415 ~n~g~~~~pl~kiaSGGE~Sr~~LAl~~~~~~--~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls-~~~Qvi~ITH~pq 491 (554) .++|.+ +|+. .+||||.+.++|||.++++. ..++|+|||||+++.++-.+-..+.+.|..+. ...||++|||-|- T Consensus 781 ~~~g~~-r~~~-~LSGGE~~~~aLAL~Lals~~~~~~~~~lflDEgfg~LD~~~~~~~~~~L~~l~~~~~qi~IISH~~e 858 (882) T PRK03918 781 VYEGKE-RPLG-FLSGGERIALGLAFRLALSMYLAGEISLLILDEPTPFLDEERRRKLVDIMERYLRKIPQVIIVSHDEE 858 (882) T ss_pred ECCCEE-CCCC-CCCHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHCCCCEEEEEECHHH T ss_conf 359836-1777-78888999999999999999871499949987997887989999999999998658998999957578 Q ss_pred HHHHCCCEEEEEEEECCCCCCEEEEEEEEC Q ss_conf 865017617999962168752589999975 Q gi|255764514|r 492 VAARADRHFLVYKTNKPDDTQRIETYVAVL 521 (554) Q Consensus 492 vAa~a~~h~~v~K~~~~~~~~~~~~~i~~l 521 (554) +...+|+-|.|.|.. + .|.|+.+ T Consensus 859 l~~~~d~~i~V~k~~-g------~S~V~~v 881 (882) T PRK03918 859 LKDAADHVIRVSLEG-G------VSKVRVV 881 (882) T ss_pred HHHHCCCEEEEEEEC-C------EEEEEEE T ss_conf 998679689999878-9------5689873 No 13 >KOG0996 consensus Probab=100.00 E-value=8.1e-38 Score=268.25 Aligned_cols=118 Identities=24% Similarity=0.286 Sum_probs=102.0 Q ss_pred CCEEEEEEECCCCCCCCCCCCCCEEEEECCCCCCCCHHHHHHCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHH Q ss_conf 63378652025322344654320011012789983113544062157999999999843668997699803446888799 Q gi|255764514|r 387 NVCFTVNITSDKEDISPDGIDRVEFYVQTNRGENPGPLMKLASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAV 466 (554) Q Consensus 387 ~a~f~i~~~~~~~~~~~~G~d~v~f~~s~n~g~~~~pl~kiaSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~ 466 (554) ||..+.++... -+|...| |.|.|.| |.+.++.+..+ ||||+-.-.|||.||+..+.|+|+||.|||||.++=++ T Consensus 1161 GGdAeLElVDs-lDPFseG---V~FSVrP-pKKSWK~I~NL-SGGEKTLSSLALVFALH~YkPTPlYVMDEIDAALDfkN 1234 (1293) T KOG0996 1161 GGDAELELVDS-LDPFSEG---VMFSVRP-PKKSWKNISNL-SGGEKTLSSLALVFALHHYKPTPLYVMDEIDAALDFKN 1234 (1293) T ss_pred CCCCEEEEECC-CCCCCCC---CEEEEEC-CHHHHHHCCCC-CCCHHHHHHHHHHHHHHCCCCCCCEEHHHHHHHHCCCC T ss_conf 88612674036-7986667---0688408-53456651167-76325789999999997169987321214777513455 Q ss_pred HHHHHHHHHHHHHCCCEEEEECHHHHHHHCCCEEEEEEEECCCCCC Q ss_conf 9999999999730593999808379865017617999962168752 Q gi|255764514|r 467 ADAIGYRLKQLSKKIQLLAVTHAPQVAARADRHFLVYKTNKPDDTQ 512 (554) Q Consensus 467 a~~v~~~l~~ls~~~Qvi~ITH~pqvAa~a~~h~~v~K~~~~~~~~ 512 (554) ...||+++|+..+++|||+|+---++=-.|++-.-|+|.. +-|+ T Consensus 1235 VSIVanYIkErTkNAQFIIISLRnnMFELa~rLvGIYKtd--n~Tk 1278 (1293) T KOG0996 1235 VSIVANYIKERTKNAQFIIISLRNNMFELANRLVGIYKTD--NCTK 1278 (1293) T ss_pred CHHHHHHHHHHCCCCEEEEEEEHHHHHHHHHHHEEEEEEC--CCCC T ss_conf 1468999998533770899972300899876652137536--8420 No 14 >cd03272 ABC_SMC3_euk Eukaryotic SMC3 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains. Amino-acid sequence homology of SMC proteins between species is largely confined to the amino- and carboxy-terminal globular domains. The amino-terminal domain contains a 'Walker A' nucleotide-binding domain (GxxGxGKS/T, in the single-letter amino-acid code), which by mutational studies has been shown to be essential in several proteins. The carboxy-terminal domain contains a sequence (the DA-box) that resembles a 'Walker B' motif, and a motif with homology to the signature sequence of the ATP-binding cassette (ABC) family of ATPases. The sequence homology within the carboxy-terminal domain is relatively high within the SMC1-SMC4 group, whereas SMC5 and SMC6 show some divergence in both of these sequences. In eukaryotic cells, the proteins are found as heterodimers of SMC1 paired with SMC3, SMC2 with SMC4, and SMC5 with SMC6 (fo Probab=100.00 E-value=4.7e-40 Score=283.00 Aligned_cols=216 Identities=23% Similarity=0.268 Sum_probs=172.6 Q ss_pred CCEEEEECCEEEE-EEEEE-CCCCEEEEECCCCCCHHHHHHHHHHHHCCCCC-------CCCCCCCC----CEEEEEEEE Q ss_conf 9259994227899-99887-38981899889997888999999987147325-------33112897----258999999 Q gi|255764514|r 1 MTRLSIYNIVLIE-SLDID-FSAGLSILSGDTGSGKSILLDALILVTGGRGD-------GGLVRRHA----EKGQVVAVF 67 (554) Q Consensus 1 L~~L~i~Nf~~i~-~~~i~-f~~Gl~vItGetGaGKS~ildAl~~~lG~r~~-------~~~Ir~g~----~~a~Ve~~F 67 (554) |++|.|..|.+|. .+.|+ |+||+|+|+||||||||+|+|||+||||.... .++|..|+ ..|.|+++| T Consensus 1 iK~i~i~GFKSf~d~t~i~~f~p~~taIVGpNGsGKSNi~dAIrwVLGe~~~~lR~~~~~dvIf~Gs~~~~~~A~Vei~f 80 (243) T cd03272 1 IKQVIIQGFKSYKDQTVIEPFSPKHNVVVGRNGSGKSNFFAAIRFVLSDEYTHLREEQRQALLHEGSGPSVMSAYVEIIF 80 (243) T ss_pred CCEEEEECEECCCCCEEECCCCCCCCEEECCCCCCCHHHHHHHHHHHCCCHHHHHHHHHHHHEECCCCCCCCEEEEEEEE T ss_conf 94799927005777657314799963798998766043677612565377555424556764425789886206999999 Q ss_pred ECCCCHHHHHHHHHCCCCCCCCEEEEEEEECCCCEEEEECCEEEECHHHHHHHHH-------HHCCCCCCCHHHHHHHHH Q ss_conf 7289737888887478988883899999943897799999988410112221110-------000012200000000367 Q gi|255764514|r 68 EISHLPALEILFAEANLTLEKHVILRRVQFPDGRTKAYVNDQVVSVNFMRAVGSL-------LIEIHSQHADRSLLDVQG 140 (554) Q Consensus 68 ~~~~~~~~~~~~~~~~~~~~~~~iirR~i~~~GkS~~~INg~~v~~~~L~~l~~~-------lidi~gQ~e~~~Ll~~~~ 140 (554) ++++... ..+.+++.+||.+. .|+|.|||||++|++..+.++... ...|.+|+.--.+++. T Consensus 81 DNsd~~~---------~~~~~Ei~irR~i~-~~~seY~iN~~~~rlkDI~~lf~~tGlg~~npy~II~QG~I~~i~n~-- 148 (243) T cd03272 81 DNSDNRF---------PIDKEEVRLRRTIG-LKKDEYFLDKKNVTKNDVMNLLESAGFSRSNPYYIVPQGKINSLTNM-- 148 (243) T ss_pred ECCCCCC---------CCCCCEEEEEEEEE-CCCCEEEECCCCCCHHHHHHHHHHCCCCCCCCCEEEECCCCCHHHCC-- T ss_conf 7888876---------89986799999995-79857989987036999999875359998998779966735330329-- Q ss_pred HHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHCCCCC Q ss_conf 87777663000013899999999999999888776655554334444332110000023443346777888986200012 Q gi|255764514|r 141 HRKILDSYADIDLSLCELGTLYRHWCCTADALKKYQEQKSSSQDVEFLRFSIDELQALAVQPGEENELVVMRSKILKQER 220 (554) Q Consensus 141 q~~lLD~~~~~~~~~~~~~~~~~~~~~~~~~l~~l~~~~~~~~e~e~l~~ql~El~~~~l~~~E~e~L~~~~~~l~~~e~ 220 (554) T Consensus 149 -------------------------------------------------------------------------------- 148 (243) T cd03272 149 -------------------------------------------------------------------------------- 148 (243) T ss_pred -------------------------------------------------------------------------------- T ss_conf -------------------------------------------------------------------------------- Q ss_pred CCCCHHHHHHHHHCCCCHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHCCCHHHHHHHHH Q ss_conf 32102345553200100179999999865431001100136676422210010799999998753000148764012356 Q gi|255764514|r 221 IAVELSSIMDDFHKSSSPISVISSMLRRLERKSTEVPDLLQKSISFLNEAQENLSDAQHEIERSFSEIQYDAQELANIEE 300 (554) Q Consensus 221 l~~~l~~~~~~l~~~~~~l~~l~~~~~~l~~~~~~~~~~l~~~~~~l~~~~~~l~e~~~el~~~~~~le~~~~~L~~ie~ 300 (554) T Consensus 149 -------------------------------------------------------------------------------- 148 (243) T cd03272 149 -------------------------------------------------------------------------------- 148 (243) T ss_pred -------------------------------------------------------------------------------- T ss_conf -------------------------------------------------------------------------------- Q ss_pred HHHHHHHHHHHHCCCHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH Q ss_conf 66788887876201115688875200002666443345777778888876765211136678999999988899999766 Q gi|255764514|r 301 RLFALRAMSRKYSVSIDQLPELAKKMEEDLADISEGNEKVVSLERVLYEARQAYDRVAQDISTKRYQFAKMLEKNVMAEM 380 (554) Q Consensus 301 Rl~~l~~L~rK~~~~~eel~~~~~~l~~~l~~l~~~~~~l~~l~~~~~~~~~~l~~~a~~Ls~~R~~~a~~L~~~i~~~L 380 (554) T Consensus 149 -------------------------------------------------------------------------------- 148 (243) T cd03272 149 -------------------------------------------------------------------------------- 148 (243) T ss_pred -------------------------------------------------------------------------------- T ss_conf -------------------------------------------------------------------------------- Q ss_pred HHHCCCCCEEEEEEECCCCCCCCCCCCCCEEEEECCCCCCCCHHHHHHCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCC Q ss_conf 65202563378652025322344654320011012789983113544062157999999999843668997699803446 Q gi|255764514|r 381 PALKLENVCFTVNITSDKEDISPDGIDRVEFYVQTNRGENPGPLMKLASGGELSRFLLALKIVLVDQGSIPTLVFDEVDS 460 (554) Q Consensus 381 ~~L~m~~a~f~i~~~~~~~~~~~~G~d~v~f~~s~n~g~~~~pl~kiaSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDa 460 (554) . |++ .+.+-. .||||+|+++||+.|++.+.+|+|||+|||||| T Consensus 149 --------------k---------------------PeE-~r~i~~-~~~~~k~~~alalifai~~~~PaPfyllDEida 191 (243) T cd03272 149 --------------K---------------------QDE-QQEMQQ-LSGGQKSLVALALIFAIQKCDPAPFYLFDEIDA 191 (243) T ss_pred --------------C---------------------HHH-HHHHHH-HCCCHHHHHHHHHHHHHHCCCCCCEEEEECCCC T ss_conf --------------9---------------------199-999999-713467799999999984559983788713440 Q ss_pred CCCHHHHHHHHHHHHHHHHCCCEEEEECHHHHHHHCCCEEEEEEE Q ss_conf 888799999999999973059399980837986501761799996 Q gi|255764514|r 461 GIGGAVADAIGYRLKQLSKKIQLLAVTHAPQVAARADRHFLVYKT 505 (554) Q Consensus 461 gi~G~~a~~v~~~l~~ls~~~Qvi~ITH~pqvAa~a~~h~~v~K~ 505 (554) .++-.+..+|+++|+++|+++|||||||-|.+-..||.-|-|.=. T Consensus 192 aLD~~~~~~v~~~ik~ls~~~QfI~ithr~~~~~~Ad~~ygV~~~ 236 (243) T cd03272 192 ALDAQYRTAVANMIKELSDGAQFITTTFRPELLEVADKFYGVKFR 236 (243) T ss_pred CCCHHHHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHEEEEEEE T ss_conf 159989999999999973498499998088999750643726985 No 15 >KOG0933 consensus Probab=100.00 E-value=1.2e-34 Score=247.37 Aligned_cols=146 Identities=16% Similarity=0.233 Sum_probs=107.3 Q ss_pred CCEEEEECCEEEEEEE--EECCCCEEEEECCCCCCHHHHHHHHHHHHCC------CCC--CCCCCCCC----CEEEEEEE Q ss_conf 9259994227899998--8738981899889997888999999987147------325--33112897----25899999 Q gi|255764514|r 1 MTRLSIYNIVLIESLD--IDFSAGLSILSGDTGSGKSILLDALILVTGG------RGD--GGLVRRHA----EKGQVVAV 66 (554) Q Consensus 1 L~~L~i~Nf~~i~~~~--i~f~~Gl~vItGetGaGKS~ildAl~~~lG~------r~~--~~~Ir~g~----~~a~Ve~~ 66 (554) +++|.+..|.+|..-+ -+|+|.||+|||-||||||+|||||||+||- ||+ -++|-.+. .+|+|+++ T Consensus 3 IkeiiLDGFKSYa~rTvI~~fDp~FNAITGlNGSGKSNILDsICFvLGI~nl~~VRA~nlqeLIyk~GQAGiTkAsVsVv 82 (1174) T KOG0933 3 IKEIILDGFKSYATRTVISGFDPQFNAITGLNGSGKSNILDSICFVLGITNLSQVRASNLQELIYKNGQAGITKASVSVV 82 (1174) T ss_pred HHHHHHCCHHCCEEEEECCCCCCCCCHHHCCCCCCCHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHCCCCCCEEEEEEEE T ss_conf 05531212001002442048886500120577777147888999998245288888878999998468666425799999 Q ss_pred EECCCCHHHHHHHHHCCCCCCCCEEEEEEEECCCCEEEEECCEEEECHHHHHHHHHH-HCCC------CCCCHHH--HHH Q ss_conf 972897378888874789888838999999438977999999884101122211100-0001------2200000--000 Q gi|255764514|r 67 FEISHLPALEILFAEANLTLEKHVILRRVQFPDGRTKAYVNDQVVSVNFMRAVGSLL-IEIH------SQHADRS--LLD 137 (554) Q Consensus 67 F~~~~~~~~~~~~~~~~~~~~~~~iirR~i~~~GkS~~~INg~~v~~~~L~~l~~~l-idi~------gQ~e~~~--Ll~ 137 (554) |++++... ...|++.-++|.++|.|...|+++|+|||+.++.+.+.+++... +.+. -|+--.. =|+ T Consensus 83 FdNtdk~~-----SP~G~E~h~EIsVtRqIv~gG~~KylINGh~a~~~~vq~lF~SVqLNvNNP~FLIMQGrITkVLNMK 157 (1174) T KOG0933 83 FDNTDKAR-----SPLGYEHHDEISVTRQIVVGGTNKYLINGHLAQNSKVQDLFCSVQLNVNNPHFLIMQGRITKVLNMK 157 (1174) T ss_pred ECCCCCCC-----CCCCCCCCCEEEEEEEEEECCCEEEEECCEECCHHHHHHHHHHHCCCCCCCCEEEECCCCHHHHCCC T ss_conf 65897456-----9998656880378999996573037776700763579999888542579985477605211321678 Q ss_pred HHHHHHHHHHHHCC Q ss_conf 36787777663000 Q gi|255764514|r 138 VQGHRKILDSYADI 151 (554) Q Consensus 138 ~~~q~~lLD~~~~~ 151 (554) |..-+.++..-||. T Consensus 158 p~EILsMvEEAAGT 171 (1174) T KOG0933 158 PSEILSMVEEAAGT 171 (1174) T ss_pred CHHHHHHHHHHHCC T ss_conf 58999999986142 No 16 >KOG0964 consensus Probab=100.00 E-value=4.4e-34 Score=243.62 Aligned_cols=111 Identities=26% Similarity=0.345 Sum_probs=95.1 Q ss_pred CEEEEECCCCCCCCHHHHHHCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCEEEEEC Q ss_conf 00110127899831135440621579999999998436689976998034468887999999999999730593999808 Q gi|255764514|r 409 VEFYVQTNRGENPGPLMKLASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSKKIQLLAVTH 488 (554) Q Consensus 409 v~f~~s~n~g~~~~pl~kiaSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~~~Qvi~ITH 488 (554) |.+.+|.|..+.-+-..+-+|||-+|.++|||.|++++++|+|||+||||||+++-.--.+||.|+++||.++||||-|. T Consensus 1079 IsI~VSFnskq~E~~~m~QLSGGQKsvvALaLIFaIQrcDPAPFYlfDEIDAaLDaQyR~aVa~lIkelS~~aQFI~TTF 1158 (1200) T KOG0964 1079 ISIKVSFNSKQGETLEMEQLSGGQKSVVALALIFAIQRCDPAPFYLFDEIDAALDAQYRTAVADLIKELSDSAQFITTTF 1158 (1200) T ss_pred EEEEEEEECCCCHHHHHHHHCCCHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHCCHHHHHHHHHHHHHHHHCCCEEEECC T ss_conf 26999851475378888883474287999999999982687401447677663068889999999999752561674316 Q ss_pred HHHHHHHCCCEEEEEEEECCCCCCEEEEEEEECCHHHH Q ss_conf 37986501761799996216875258999997598899 Q gi|255764514|r 489 APQVAARADRHFLVYKTNKPDDTQRIETYVAVLTPQER 526 (554) Q Consensus 489 ~pqvAa~a~~h~~v~K~~~~~~~~~~~~~i~~l~~~~r 526 (554) -|-+-+.||.-|-|.=... .|.|..++.++- T Consensus 1159 RpEll~vAdKfygV~f~nK-------vS~V~~It~e~A 1189 (1200) T KOG0964 1159 RPELLSVADKFYGVKFENK-------VSTVDEITREQA 1189 (1200) T ss_pred CHHHHHHHHHHHCEEECCC-------CCCCEEEEHHHH T ss_conf 4899987776520132144-------330000209999 No 17 >KOG0018 consensus Probab=100.00 E-value=1.1e-32 Score=234.38 Aligned_cols=119 Identities=20% Similarity=0.294 Sum_probs=99.1 Q ss_pred HHHHHCCCCCEEEEEEECCCCCCCCCCCCCCEEEEECCCCCCCCHHHHHHCCHHHHHHHHHHHHHHCCCCCCCEEEEECC Q ss_conf 66652025633786520253223446543200110127899831135440621579999999998436689976998034 Q gi|255764514|r 379 EMPALKLENVCFTVNITSDKEDISPDGIDRVEFYVQTNRGENPGPLMKLASGGELSRFLLALKIVLVDQGSIPTLVFDEV 458 (554) Q Consensus 379 ~L~~L~m~~a~f~i~~~~~~~~~~~~G~d~v~f~~s~n~g~~~~pl~kiaSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEi 458 (554) .-+.|.+..|..-+.+. ++++|.-.| |.|-..| ||+.++|+. -+||||+.-.+|||.|++..+.|+||+||||| T Consensus 1009 IYK~Ltnt~g~AyL~~e-n~~EPyl~G---Iky~~~p-P~KRFr~M~-~LSGGEKTvAaLALLFaiHsy~PaPFFvlDEi 1082 (1141) T KOG0018 1009 IYKELTNTEGQAYLGLE-NPEEPYLDG---IKYHCMP-PGKRFRPMD-NLSGGEKTVAALALLFAIHSYKPAPFFVLDEI 1082 (1141) T ss_pred HHHHHCCCCCCEEECCC-CCCCCHHCC---CCCCCCC-CCCCCCCHH-HCCCCHHHHHHHHHHHHHCCCCCCCCEEHHHH T ss_conf 99985341022422689-987411117---2011059-844467344-23762799999999999605799873012157 Q ss_pred CCCCCHHHHHHHHHHHHHHHHCCCEEEEECHHHHHHHCCCEEEEEEE Q ss_conf 46888799999999999973059399980837986501761799996 Q gi|255764514|r 459 DSGIGGAVADAIGYRLKQLSKKIQLLAVTHAPQVAARADRHFLVYKT 505 (554) Q Consensus 459 Dagi~G~~a~~v~~~l~~ls~~~Qvi~ITH~pqvAa~a~~h~~v~K~ 505 (554) ||.++--++.+||.+++ +.+.||||||-=|+.=.+||.-.-|+.. T Consensus 1083 DAALDntNi~kvasyIr--~~~~Q~IVISLK~~fy~kadaLVGvyr~ 1127 (1141) T KOG0018 1083 DAALDNTNIGKVASYIR--SSNFQFIVISLKEEFYQKADALVGVYRD 1127 (1141) T ss_pred HHHHHHCCHHHHHHHHH--CCCCEEEEEECCHHHHHHHHCEEEECCC T ss_conf 77750014899999985--5896499996408776300002332357 No 18 >cd03274 ABC_SMC4_euk Eukaryotic SMC4 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains. Amino-acid sequence homology of SMC proteins between species is largely confined to the amino- and carboxy-terminal globular domains. The amino-terminal domain contains a 'Walker A' nucleotide-binding domain (GxxGxGKS/T, in the single-letter amino-acid code), which by mutational studies has been shown to be essential in several proteins. The carboxy-terminal domain contains a sequence (the DA-box) that resembles a 'Walker B' motif, and a motif with homology to the signature sequence of the ATP-binding cassette (ABC) family of ATPases. The sequence homology within the carboxy-terminal domain is relatively high within the SMC1-SMC4 group, whereas SMC5 and SMC6 show some divergence in both of these sequences. In eukaryotic cells, the proteins are found as heterodimers of SMC1 paired with SMC3, SMC2 with SMC4, and SMC5 with SMC6 (fo Probab=100.00 E-value=2.9e-35 Score=251.41 Aligned_cols=91 Identities=25% Similarity=0.278 Sum_probs=87.3 Q ss_pred CCCCCCHHHHHHCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCEEEEECHHHHHHHC Q ss_conf 89983113544062157999999999843668997699803446888799999999999973059399980837986501 Q gi|255764514|r 417 RGENPGPLMKLASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSKKIQLLAVTHAPQVAARA 496 (554) Q Consensus 417 ~g~~~~pl~kiaSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~~~Qvi~ITH~pqvAa~a 496 (554) ||++++.++ .+||||+|.++|||.|++..++|+||||||||||.++..+..+++++++++++++|||+|||-+++-..| T Consensus 118 PgK~~k~is-~LSGGEKsLtAlALlFAi~~~kPsPFyvLDEVDAALD~~Nv~r~a~~ike~s~~aQFIVIThr~~tme~A 196 (212) T cd03274 118 PKKSWKNIS-NLSGGEKTLSSLALVFALHHYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELA 196 (212) T ss_pred CCHHHHHHH-HCCCHHHHHHHHHHHHHHHCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHCCCCEEEEEECCHHHHHHH T ss_conf 641334465-6275189999999999996428995589735642467888999999999847797699998588999851 Q ss_pred CCEEEEEEEECC Q ss_conf 761799996216 Q gi|255764514|r 497 DRHFLVYKTNKP 508 (554) Q Consensus 497 ~~h~~v~K~~~~ 508 (554) |.-|-|+|.... T Consensus 197 D~L~GV~~~~~~ 208 (212) T cd03274 197 DRLVGIYKTNNC 208 (212) T ss_pred HHEEEEEEECCC T ss_conf 517989973785 No 19 >cd03273 ABC_SMC2_euk Eukaryotic SMC2 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains. Amino-acid sequence homology of SMC proteins between species is largely confined to the amino- and carboxy-terminal globular domains. The amino-terminal domain contains a 'Walker A' nucleotide-binding domain (GxxGxGKS/T, in the single-letter amino-acid code), which by mutational studies has been shown to be essential in several proteins. The carboxy-terminal domain contains a sequence (the DA-box) that resembles a 'Walker B' motif, and a motif with homology to the signature sequence of the ATP-binding cassette (ABC) family of ATPases. The sequence homology within the carboxy-terminal domain is relatively high within the SMC1-SMC4 group, whereas SMC5 and SMC6 show some divergence in both of these sequences. In eukaryotic cells, the proteins are found as heterodimers of SMC1 paired with SMC3, SMC2 with SMC4, and SMC5 with SMC6 (fo Probab=100.00 E-value=1.9e-34 Score=246.06 Aligned_cols=221 Identities=21% Similarity=0.236 Sum_probs=171.2 Q ss_pred CCEEEEECCEEEE-EEEE-ECCCCEEEEECCCCCCHHHHHHHHHHHHCCCC------C--CCCCCCCC----CEEEEEEE Q ss_conf 9259994227899-9988-73898189988999788899999998714732------5--33112897----25899999 Q gi|255764514|r 1 MTRLSIYNIVLIE-SLDI-DFSAGLSILSGDTGSGKSILLDALILVTGGRG------D--GGLVRRHA----EKGQVVAV 66 (554) Q Consensus 1 L~~L~i~Nf~~i~-~~~i-~f~~Gl~vItGetGaGKS~ildAl~~~lG~r~------~--~~~Ir~g~----~~a~Ve~~ 66 (554) |++|.|..|.+|. .++| +|+||+|+||||||||||+|+|||+||||..+ + .++|-.|. ..|.|+.+ T Consensus 3 ik~i~i~GFKSF~d~T~i~~f~~g~taIVGPNGsGKSNI~DAIrwVLGe~s~k~LRg~~m~DvIF~g~~~~~~~A~V~l~ 82 (251) T cd03273 3 IKEIILDGFKSYATRTVISGFDPQFNAITGLNGSGKSNILDAICFVLGITNLSTVRASNLQDLIYKRGQAGITKASVTIV 82 (251) T ss_pred EEEEEECCCCCCCCCEEEEECCCCCEEEECCCCCCHHHHHHHHHHHHCCCCHHHHCCCCCCEEEECCCCCCCEEEEEEEE T ss_conf 66999807226788778850599956999999886688999999997567443412135551688899999612699999 Q ss_pred EECCCCHHHHHHHHHCCCCCCCCEEEEEEEECCCCEEEEECCEEEECHHHHHHHHHH-------HCCCCCCCHHHHHHHH Q ss_conf 972897378888874789888838999999438977999999884101122211100-------0001220000000036 Q gi|255764514|r 67 FEISHLPALEILFAEANLTLEKHVILRRVQFPDGRTKAYVNDQVVSVNFMRAVGSLL-------IEIHSQHADRSLLDVQ 139 (554) Q Consensus 67 F~~~~~~~~~~~~~~~~~~~~~~~iirR~i~~~GkS~~~INg~~v~~~~L~~l~~~l-------idi~gQ~e~~~Ll~~~ 139 (554) |++++.... ..+....+++.|+|.+.++|.|.|+|||++|++.+++++.... -.|.+|+.-..+++. T Consensus 83 fdN~d~~~~-----p~~~~~~~EI~ItRri~r~G~seY~INg~~~R~kDI~~lF~dtglg~~sp~~II~QGrI~~iln~- 156 (251) T cd03273 83 FDNSDKSQS-----PIGFENYPEITVTRQIVLGGTNKYLINGHRAQQQRVQDLFQSVQLNVNNPHFLIMQGRITKVLNM- 156 (251) T ss_pred ECCCCCCCC-----CCCCCCCCEEEEEEEEEECCCCEEEECCCEECHHHHHHHHHHCCCCCCCCCEEEECCCHHHHHCC- T ss_conf 726875458-----76557788799999999888857989976645999999974437898998606757748898838- Q ss_pred HHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHCCCC Q ss_conf 78777766300001389999999999999988877665555433444433211000002344334677788898620001 Q gi|255764514|r 140 GHRKILDSYADIDLSLCELGTLYRHWCCTADALKKYQEQKSSSQDVEFLRFSIDELQALAVQPGEENELVVMRSKILKQE 219 (554) Q Consensus 140 ~q~~lLD~~~~~~~~~~~~~~~~~~~~~~~~~l~~l~~~~~~~~e~e~l~~ql~El~~~~l~~~E~e~L~~~~~~l~~~e 219 (554) T Consensus 157 -------------------------------------------------------------------------------- 156 (251) T cd03273 157 -------------------------------------------------------------------------------- 156 (251) T ss_pred -------------------------------------------------------------------------------- T ss_conf -------------------------------------------------------------------------------- Q ss_pred CCCCCHHHHHHHHHCCCCHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHCCCHHHHHHHH Q ss_conf 23210234555320010017999999986543100110013667642221001079999999875300014876401235 Q gi|255764514|r 220 RIAVELSSIMDDFHKSSSPISVISSMLRRLERKSTEVPDLLQKSISFLNEAQENLSDAQHEIERSFSEIQYDAQELANIE 299 (554) Q Consensus 220 ~l~~~l~~~~~~l~~~~~~l~~l~~~~~~l~~~~~~~~~~l~~~~~~l~~~~~~l~e~~~el~~~~~~le~~~~~L~~ie 299 (554) .| T Consensus 157 -----------------------------------------------------------------------kp------- 158 (251) T cd03273 157 -----------------------------------------------------------------------GG------- 158 (251) T ss_pred -----------------------------------------------------------------------CH------- T ss_conf -----------------------------------------------------------------------97------- Q ss_pred HHHHHHHHHHHHHCCCHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH Q ss_conf 66678888787620111568887520000266644334577777888887676521113667899999998889999976 Q gi|255764514|r 300 ERLFALRAMSRKYSVSIDQLPELAKKMEEDLADISEGNEKVVSLERVLYEARQAYDRVAQDISTKRYQFAKMLEKNVMAE 379 (554) Q Consensus 300 ~Rl~~l~~L~rK~~~~~eel~~~~~~l~~~l~~l~~~~~~l~~l~~~~~~~~~~l~~~a~~Ls~~R~~~a~~L~~~i~~~ 379 (554) .. T Consensus 159 ---------------------------------------------------------------~e--------------- 160 (251) T cd03273 159 ---------------------------------------------------------------VW--------------- 160 (251) T ss_pred ---------------------------------------------------------------HH--------------- T ss_conf ---------------------------------------------------------------99--------------- Q ss_pred HHHHCCCCCEEEEEEECCCCCCCCCCCCCCEEEEECCCCCCCCHHHHHHCCHHHHHHHHHHHHHHCCCCCCCEEEEECCC Q ss_conf 66520256337865202532234465432001101278998311354406215799999999984366899769980344 Q gi|255764514|r 380 MPALKLENVCFTVNITSDKEDISPDGIDRVEFYVQTNRGENPGPLMKLASGGELSRFLLALKIVLVDQGSIPTLVFDEVD 459 (554) Q Consensus 380 L~~L~m~~a~f~i~~~~~~~~~~~~G~d~v~f~~s~n~g~~~~pl~kiaSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiD 459 (554) -+.|-+ -++|.+|.++|+|.+++..+.|+|+||||||| T Consensus 161 -----------------------------------------Rr~l~E-EAAG~rsl~al~li~a~l~~kpap~yildeid 198 (251) T cd03273 161 -----------------------------------------KESLTE-LSGGQRSLVALSLILALLLFKPAPMYILDEVD 198 (251) T ss_pred -----------------------------------------HHHHHH-HHCCHHHHHHHHHHHHHHHCCCCCCCCHHHHH T ss_conf -----------------------------------------999999-85454578888889999735897630123345 Q ss_pred CCCCHHHHHHHHHHHHHHHHCCCEEEEECHHHHHHHCCCEEEEEEE Q ss_conf 6888799999999999973059399980837986501761799996 Q gi|255764514|r 460 SGIGGAVADAIGYRLKQLSKKIQLLAVTHAPQVAARADRHFLVYKT 505 (554) Q Consensus 460 agi~G~~a~~v~~~l~~ls~~~Qvi~ITH~pqvAa~a~~h~~v~K~ 505 (554) |.++-.....+|.++|+-.++.|||+|||--.+=..|+.-|.|.=. T Consensus 199 aaLd~~~t~~i~~~~k~~~~~sqfivvs~k~~m~~~a~~l~~~~~~ 244 (251) T cd03273 199 AALDLSHTQNIGRMIKTHFKGSQFIVVSLKEGMFNNANVLFRTRFV 244 (251) T ss_pred HHHHHHHHHHHHHHHHHHCCCCEEEEEECHHHHHHHHHHHEEEEEE T ss_conf 4431033678999998508665489998558787642623465775 No 20 >COG0419 SbcC ATPase involved in DNA repair [DNA replication, recombination, and repair] Probab=100.00 E-value=6.5e-29 Score=209.55 Aligned_cols=85 Identities=26% Similarity=0.328 Sum_probs=76.3 Q ss_pred CCHHHHHHCCHHHHHHHHHHHHHHCCC----CCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHC-CCEEEEECHHHHHHH Q ss_conf 311354406215799999999984366----899769980344688879999999999997305-939998083798650 Q gi|255764514|r 421 PGPLMKLASGGELSRFLLALKIVLVDQ----GSIPTLVFDEVDSGIGGAVADAIGYRLKQLSKK-IQLLAVTHAPQVAAR 495 (554) Q Consensus 421 ~~pl~kiaSGGE~Sr~~LAl~~~~~~~----~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~~-~Qvi~ITH~pqvAa~ 495 (554) .+|+. .+||||.-.++|||.++++++ .++|++++||.-.+++-..-..++..|..+... .|||||||-|.+..+ T Consensus 810 ~r~~~-~LSGGE~~~~sLalrLALs~~~~~~~~l~~l~LDEpf~~LD~e~l~~l~~~l~~i~~~~~qiiIISH~eel~e~ 888 (908) T COG0419 810 VRPIK-TLSGGERFLASLALRLALSDLLQGRARLELLFLDEPFGTLDEERLEKLAEILEELLSDGRQIIIISHVEELKER 888 (908) T ss_pred CEECC-CCCCHHHHHHHHHHHHHHHHHHHCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCEEEEEECHHHHHHH T ss_conf 22102-04861899999999999999972488888233428988789899999999999998459979999566999985 Q ss_pred CCCEEEEEEEE Q ss_conf 17617999962 Q gi|255764514|r 496 ADRHFLVYKTN 506 (554) Q Consensus 496 a~~h~~v~K~~ 506 (554) +|+-+.|.|.. T Consensus 889 ~~~~i~V~k~~ 899 (908) T COG0419 889 ADVRIRVKKDG 899 (908) T ss_pred HCCEEEEEECC T ss_conf 07578998459 No 21 >KOG0979 consensus Probab=100.00 E-value=1.1e-28 Score=208.12 Aligned_cols=106 Identities=20% Similarity=0.379 Sum_probs=94.7 Q ss_pred CCEEEEECCEEEEEEEEECCCCEEEEECCCCCCHHHHHHHHHHHHCCC------CC--CCCCCCCCCEEEEEEEEECCCC Q ss_conf 925999422789999887389818998899978889999999871473------25--3311289725899999972897 Q gi|255764514|r 1 MTRLSIYNIVLIESLDIDFSAGLSILSGDTGSGKSILLDALILVTGGR------GD--GGLVRRHAEKGQVVAVFEISHL 72 (554) Q Consensus 1 L~~L~i~Nf~~i~~~~i~f~~Gl~vItGetGaGKS~ildAl~~~lG~r------~~--~~~Ir~g~~~a~Ve~~F~~~~~ 72 (554) |.++.++||..|+.+++.|+|.||.|+||||||||+|+.|||++|||+ +. ..+||+|++.+.|+++.... T Consensus 22 IvrI~l~NF~Ty~~~e~~pgpsLNmIiGpNGSGKSSiVcAIcLglgG~Pk~lGRak~VgeyIK~G~~~g~IEI~l~~~-- 99 (1072) T KOG0979 22 IVRIELHNFLTYDHTEFLPGPSLNMIIGPNGSGKSSIVCAICLGLGGKPKLLGRAKKVGEYIKRGEDEGYIEIELKDK-- 99 (1072) T ss_pred EEEEEEEEEEEEEEEEECCCCCEEEEECCCCCCCHHHHHHHHHHCCCCHHHCCCHHHHHHHHHCCCCCCEEEEEEECC-- T ss_conf 699997400444333443788612687789897048899999972797443143557999996477663699999627-- Q ss_pred HHHHHHHHHCCCCCCCCEEEEEEEECCCCEEEEECCEEEECHHHHHHHHH Q ss_conf 37888887478988883899999943897799999988410112221110 Q gi|255764514|r 73 PALEILFAEANLTLEKHVILRRVQFPDGRTKAYVNDQVVSVNFMRAVGSL 122 (554) Q Consensus 73 ~~~~~~~~~~~~~~~~~~iirR~i~~~GkS~~~INg~~v~~~~L~~l~~~ 122 (554) ++.+.|.|.|+.+++|.|||||..|+.+.+.++... T Consensus 100 --------------~e~~~ItR~I~~~k~S~y~iN~~a~t~s~i~elv~~ 135 (1072) T KOG0979 100 --------------DETLTITRLISRDKESKYFINDSATTKSEIEELVAH 135 (1072) T ss_pred --------------CCCEEEEEEEEECCCCCEEECCCHHHHHHHHHHHHH T ss_conf --------------886479998730577535545521006899999999 No 22 >KOG0250 consensus Probab=99.98 E-value=3.4e-29 Score=211.42 Aligned_cols=138 Identities=25% Similarity=0.345 Sum_probs=105.2 Q ss_pred CCEEEEECCEEEEEEEEECCCCEEEEECCCCCCHHHHHHHHHHHHCCCCC--------CCCCCCCCCEEEEEEEEECCCC Q ss_conf 92599942278999988738981899889997888999999987147325--------3311289725899999972897 Q gi|255764514|r 1 MTRLSIYNIVLIESLDIDFSAGLSILSGDTGSGKSILLDALILVTGGRGD--------GGLVRRHAEKGQVVAVFEISHL 72 (554) Q Consensus 1 L~~L~i~Nf~~i~~~~i~f~~Gl~vItGetGaGKS~ildAl~~~lG~r~~--------~~~Ir~g~~~a~Ve~~F~~~~~ 72 (554) +.++++.||++|+++.|+|+|.+|.|+|+||||||.||.||+++||+||+ +++|+.|+..|.|.++.++++. T Consensus 42 I~sI~L~NFMCHsnL~IeFg~~vNfI~G~NGSGKSAIltAl~lglG~rAs~tnRgsslK~lIK~G~~~A~IsItL~N~G~ 121 (1074) T KOG0250 42 IESIHLTNFMCHSNLLIEFGPRVNFIVGNNGSGKSAILTALTLGLGGRASATNRGSSLKDLIKDGCSSAKISITLSNSGL 121 (1074) T ss_pred EEEEEEEEECCCCCCEECCCCCCEEEECCCCCCHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHCCCCCEEEEEEEECCCC T ss_conf 89999752103335410258871376468987489999999986265314565304399999678751489999825776 Q ss_pred HHHHHHHHHCCCCCCCCEEEEEEEECCCCEEEEE---CCEEEECH--HHHHHHHHHHCCCCCCCH-HHHHHHHHHHHHHH Q ss_conf 3788888747898888389999994389779999---99884101--122211100000122000-00000367877776 Q gi|255764514|r 73 PALEILFAEANLTLEKHVILRRVQFPDGRTKAYV---NDQVVSVN--FMRAVGSLLIEIHSQHAD-RSLLDVQGHRKILD 146 (554) Q Consensus 73 ~~~~~~~~~~~~~~~~~~iirR~i~~~GkS~~~I---Ng~~v~~~--~L~~l~~~lidi~gQ~e~-~~Ll~~~~q~~lLD 146 (554) .+++. -.|++.|+|-|+|..+|.+.|.. ||+.||.. .|..+..++- | |.++ ...|+.+.-+++|- T Consensus 122 ~Afk~------eiyG~~IiIER~I~~~~S~~~~~~~~~grvVStKk~dl~~vv~~f~-I--~veNP~~~lsQD~aR~FL~ 192 (1074) T KOG0250 122 DAFKP------EIYGNSIIIERTIRRSSSTYYLLRSANGRVVSTKKEDLDTVVDHFN-I--QVENPMFVLSQDAARSFLA 192 (1074) T ss_pred CCCCH------HHCCCEEEEEEEECCCCCHHHHHHHCCCCCCCCCHHHHHHHHHHHC-C--CCCCCCHHHCHHHHHHHHH T ss_conf 66774------5438805999862356525888760367622361988999999828-6--7778402304888999985 Q ss_pred H Q ss_conf 6 Q gi|255764514|r 147 S 147 (554) Q Consensus 147 ~ 147 (554) . T Consensus 193 ~ 193 (1074) T KOG0250 193 N 193 (1074) T ss_pred C T ss_conf 4 No 23 >cd03239 ABC_SMC_head The structural maintenance of chromosomes (SMC) proteins are essential for successful chromosome transmission during replication and segregation of the genome in all organisms. SMCs are generally present as single proteins in bacteria, and as at least six distinct proteins in eukaryotes. The proteins range in size from approximately 110 to 170 kDa, and each has five distinct domains: amino- and carboxy-terminal globular domains, which contain sequences characteristic of ATPases, two coiled-coil regions separating the terminal domains , and a central flexible hinge. SMC proteins function together with other proteins in a range of chromosomal transactions, including chromosome condensation, sister-chromatid cohesion, recombination, DNA repair, and epigenetic silencing of gene expression. Probab=99.96 E-value=2.9e-29 Score=211.86 Aligned_cols=79 Identities=27% Similarity=0.333 Sum_probs=75.5 Q ss_pred HCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHC-CCEEEEECHHHHHHHCCCEEEEEEEE Q ss_conf 06215799999999984366899769980344688879999999999997305-93999808379865017617999962 Q gi|255764514|r 428 ASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSKK-IQLLAVTHAPQVAARADRHFLVYKTN 506 (554) Q Consensus 428 aSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~~-~Qvi~ITH~pqvAa~a~~h~~v~K~~ 506 (554) +||||+|+++||+.+++...+|+|+||||||||+++..+..+++++|++++++ .|||+|||-+.....||+-|-|.-.. T Consensus 95 LSGGEksl~alal~~ai~~~~p~p~~iLDEvdAaLD~~N~~r~~~~i~el~~~~sQfIiITH~~~~m~~ad~l~gVtm~~ 174 (178) T cd03239 95 LSGGEKSLSALALIFALQEIKPSPFYVLDEIDAALDPTNRRRVSDMIKEMAKHTSQFIVITLKKEMFENADKLIGVLFVH 174 (178) T ss_pred CCCCHHHHHHHHHHHHHHCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCEEEEEECCHHHHHHCCEEEEEEECC T ss_conf 67525899999999999713899669982765547988999999999999738998999986899997478589998028 No 24 >PRK00064 recF recombination protein F; Reviewed Probab=99.93 E-value=1.6e-21 Score=160.90 Aligned_cols=151 Identities=21% Similarity=0.252 Sum_probs=108.1 Q ss_pred CCEEEEECCEEEEEEEEECCCCEEEEECCCCCCHHHHHHHHHHHHCCCCC-----CCCCCCCCCEEEEEEEEECCCCHHH Q ss_conf 92599942278999988738981899889997888999999987147325-----3311289725899999972897378 Q gi|255764514|r 1 MTRLSIYNIVLIESLDIDFSAGLSILSGDTGSGKSILLDALILVTGGRGD-----GGLVRRHAEKGQVVAVFEISHLPAL 75 (554) Q Consensus 1 L~~L~i~Nf~~i~~~~i~f~~Gl~vItGetGaGKS~ildAl~~~lG~r~~-----~~~Ir~g~~~a~Ve~~F~~~~~~~~ 75 (554) |++|+|.||..|.+++++|+||+|+|+|+||||||+||+||.++..+|+. .++|++|++.+.|.+.|...+ T Consensus 3 i~~L~l~nFRn~~~~~l~~~~~~n~i~G~NGsGKTnlLEAI~~L~~grSfR~~~~~~li~~~~~~~~v~a~~~~~~---- 78 (355) T PRK00064 3 LTRLSLTDFRNYEELDLELSPGVNVLVGENGQGKTNLLEAIYLLAPGRSHRTARDKELIRFGAEAAVVHARVQKGG---- 78 (355) T ss_pred ECEEEEECCCCCCCCEEECCCCEEEEECCCCCCHHHHHHHHHHHCCCCCCCCCCHHHHHCCCCCCEEEEEEEEECC---- T ss_conf 0878873655985347834998089999998888999999999848988888986999728998789999998389---- Q ss_pred HHHHHHCCCCCCCCEEEEEEEECCCCEEEEECCEEEEC-HHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHCCHHH Q ss_conf 88887478988883899999943897799999988410-11222111000001220000000036787777663000013 Q gi|255764514|r 76 EILFAEANLTLEKHVILRRVQFPDGRTKAYVNDQVVSV-NFMRAVGSLLIEIHSQHADRSLLDVQGHRKILDSYADIDLS 154 (554) Q Consensus 76 ~~~~~~~~~~~~~~~iirR~i~~~GkS~~~INg~~v~~-~~L~~l~~~lidi~gQ~e~~~Ll~~~~q~~lLD~~~~~~~~ 154 (554) .+..+.-.+..+|+.+.+|||.+++. +.+....+.. -|+.+......-.|..+|.+||...-.- T Consensus 79 ------------~~~~i~i~~~~~~~~~~~ing~~~~~~s~l~~~lp~v-~~~P~~~~li~g~p~~RR~flD~~~~~~-- 143 (355) T PRK00064 79 ------------GELPLGLEISRKGKRRVRINGEPQRKLSELAGLLNVV-LFTPEDLRLVKGGPSERRRFLDRLLFQI-- 143 (355) T ss_pred ------------CEEEEEEEECCCCCEEEEECCEECCCHHHHHHHCCEE-EECCCHHHHHCCCHHHHHHHHHHHHHHC-- T ss_conf ------------2589999983699659999992164789997228699-9863557676079789999978765524-- Q ss_pred HHHHHHHHHHHHHHHH Q ss_conf 8999999999999998 Q gi|255764514|r 155 LCELGTLYRHWCCTAD 170 (554) Q Consensus 155 ~~~~~~~~~~~~~~~~ 170 (554) -..|...+..|+.+.+ T Consensus 144 ~~~y~~~l~~y~k~Lk 159 (355) T PRK00064 144 EPVYASALSQYERALK 159 (355) T ss_pred CHHHHHHHHHHHHHHH T ss_conf 9189999999999999 No 25 >PRK10246 exonuclease subunit SbcC; Provisional Probab=99.92 E-value=3.3e-21 Score=158.77 Aligned_cols=99 Identities=23% Similarity=0.213 Sum_probs=75.7 Q ss_pred EEEEECC-CCCCCCHHHHHHCCHHHHHHHHHHHHHHCC----CCCCCEEEEECCCCCCCHHHHHHHHHHHHHH-HHCCCE Q ss_conf 0110127-899831135440621579999999998436----6899769980344688879999999999997-305939 Q gi|255764514|r 410 EFYVQTN-RGENPGPLMKLASGGELSRFLLALKIVLVD----QGSIPTLVFDEVDSGIGGAVADAIGYRLKQL-SKKIQL 483 (554) Q Consensus 410 ~f~~s~n-~g~~~~pl~kiaSGGE~Sr~~LAl~~~~~~----~~~~p~~ifDEiDagi~G~~a~~v~~~l~~l-s~~~Qv 483 (554) +|.|.-+ .|...+|.+ .+||||--+++|||.++++. ..+..||+.||==--++-.+.+.|-.-|..| +.+.-| T Consensus 932 ~l~V~D~~~g~~~R~v~-TLSGGEtF~aSLALALgLsdvvq~~~~ldtlFIDEGFGSLD~e~Ld~a~~aL~~L~~~gR~V 1010 (1047) T PRK10246 932 ELEVVDTWQADAVRDTR-TLSGGESFLVSLALALALSDLVSHKTRIDSLFLDEGFGTLDSETLDTALDALDALNASGKTI 1010 (1047) T ss_pred EEEEEECCCCCCEECCC-CCCHHHHHHHHHHHHHHHHHHHHCCCCCCCEEECCCCCCCCHHHHHHHHHHHHHHHHCCCEE T ss_conf 27998857899746897-88725999999999999999984899888465679977769889999999999999688989 Q ss_pred EEEECHHHHHHHCCCEEEEEEEECCC Q ss_conf 99808379865017617999962168 Q gi|255764514|r 484 LAVTHAPQVAARADRHFLVYKTNKPD 509 (554) Q Consensus 484 i~ITH~pqvAa~a~~h~~v~K~~~~~ 509 (554) -+|||-|.+..+=+.++.|.|....| T Consensus 1011 GIISHV~ELkerIp~~i~V~K~~g~g 1036 (1047) T PRK10246 1011 GVISHVEAMKERIPVQIKVKKINGLG 1036 (1047) T ss_pred EEECCHHHHHHHCCCEEEEEECCCCC T ss_conf 99888788998679879999679987 No 26 >cd03242 ABC_RecF RecF is a recombinational DNA repair ATPase that maintains replication in the presence of DNA damage. When replication is prematurely disrupted by DNA damage, several recF pathway gene products play critical roles processing the arrested replication fork, allowing it to resume and complete its task. This CD represents the nucleotide binding domain of RecF. RecF belongs to a large superfamily of ABC transporters involved in the transport of a wide variety of different compounds including sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases with a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins. Probab=99.90 E-value=2.5e-21 Score=159.60 Aligned_cols=152 Identities=20% Similarity=0.267 Sum_probs=107.3 Q ss_pred CCEEEEECCEEEEEEEEECCCCEEEEECCCCCCHHHHHHHHHHHHCCCCC-----CCCCCCCCCEEEEEEEEECCCCHHH Q ss_conf 92599942278999988738981899889997888999999987147325-----3311289725899999972897378 Q gi|255764514|r 1 MTRLSIYNIVLIESLDIDFSAGLSILSGDTGSGKSILLDALILVTGGRGD-----GGLVRRHAEKGQVVAVFEISHLPAL 75 (554) Q Consensus 1 L~~L~i~Nf~~i~~~~i~f~~Gl~vItGetGaGKS~ildAl~~~lG~r~~-----~~~Ir~g~~~a~Ve~~F~~~~~~~~ 75 (554) |++|++.||..+++++++|+||+|+|.|+|||||++||+||.++..+|+. .++|++|++.+.|.+.+...+. T Consensus 1 i~~L~l~nFRn~~~~~l~~~~~~n~i~G~NGsGKTnlLEAI~~ls~grSFR~~~~~~lI~~~~~~~~v~~~~~~~~~--- 77 (270) T cd03242 1 LKSLELRNFRNYAELELEFEPGVTVLVGENAQGKTNLLEAISLLATGKSHRTSRDKELIRWGAEEAKISAVLERQGG--- 77 (270) T ss_pred CCEEEEECCCCCCCCEEECCCCCEEEECCCCCCHHHHHHHHHHHHCCCCCCCCCHHHHHCCCCCCEEEEEEEEECCC--- T ss_conf 96787647669850567249994899999988789999999998179988867558885278985899999998996--- Q ss_pred HHHHHHCCCCCCCCEEEEEEEECCCCEEEEECCEEEE-CHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHCCHHH Q ss_conf 8888747898888389999994389779999998841-011222111000001220000000036787777663000013 Q gi|255764514|r 76 EILFAEANLTLEKHVILRRVQFPDGRTKAYVNDQVVS-VNFMRAVGSLLIEIHSQHADRSLLDVQGHRKILDSYADIDLS 154 (554) Q Consensus 76 ~~~~~~~~~~~~~~~iirR~i~~~GkS~~~INg~~v~-~~~L~~l~~~lidi~gQ~e~~~Ll~~~~q~~lLD~~~~~~~~ 154 (554) ...+.-.+..+++.+.+|||..++ .+.+....+. +-++.+......-.|..+|.+||...-.- T Consensus 78 -------------~~~~~~~~~~~~~k~~~in~~~~~~~s~l~~~lp~-v~~~P~~~~li~g~p~~RR~flD~~i~~~-- 141 (270) T cd03242 78 -------------ELALELTIRSGGGRKARLNGIKVRRLSDLLGVLNA-VWFAPEDLELVKGSPADRRRFLDRLLGQL-- 141 (270) T ss_pred -------------EEEEEEEEECCCCEEEEECCCCCCCHHHHHHHCCE-EEEECCHHHHHHCCHHHHHHHHHHHHHHC-- T ss_conf -------------07999999439954999999035048988710888-99923755466179488999999999862-- Q ss_pred HHHHHHHHHHHHHHHHH Q ss_conf 89999999999999988 Q gi|255764514|r 155 LCELGTLYRHWCCTADA 171 (554) Q Consensus 155 ~~~~~~~~~~~~~~~~~ 171 (554) -..|...+..|..+.++ T Consensus 142 ~~~y~~~l~~Y~k~LkQ 158 (270) T cd03242 142 EPAYAHVLSEYQKALRQ 158 (270) T ss_pred CHHHHHHHHHHHHHHHH T ss_conf 99999999999999999 No 27 >TIGR03185 DNA_S_dndD DNA sulfur modification protein DndD. This model describes the DndB protein encoded by an operon associated with a sulfur-containing modification to DNA. The operon is sporadically distributed in bacteria, much like some restriction enzyme operons. DndD is described as a putative ATPase. The small number of examples known so far include species from among the Firmicutes, Actinomycetes, Proteobacteria, and Cyanobacteria. Probab=99.90 E-value=5e-18 Score=137.81 Aligned_cols=99 Identities=22% Similarity=0.357 Sum_probs=67.2 Q ss_pred CCEEEEECCEEEE-EEEEECCC----CEEEEECCCCCCHHHHHHHHHHHHCCCCC--------------CCCCCCC---C Q ss_conf 9259994227899-99887389----81899889997888999999987147325--------------3311289---7 Q gi|255764514|r 1 MTRLSIYNIVLIE-SLDIDFSA----GLSILSGDTGSGKSILLDALILVTGGRGD--------------GGLVRRH---A 58 (554) Q Consensus 1 L~~L~i~Nf~~i~-~~~i~f~~----Gl~vItGetGaGKS~ildAl~~~lG~r~~--------------~~~Ir~g---~ 58 (554) |.+|.+.||..|. ..+++|+| .+++|-|.|||||++||+||.|||.|+-. .+.+..+ . T Consensus 3 l~~i~l~Nf~~y~g~~~~~~~~~~~k~i~li~G~NG~GKTTll~Ai~~~LYG~~~~~~~~~~~~y~~~~~~~~n~~~~~~ 82 (650) T TIGR03185 3 IKQLTLENFGAYRGRQTFDLSPSSPKPIILIGGLNGAGKTTLLDAIQLGLYGKRAYCSKRGNQSYEQYLHGYINRSAGKT 82 (650) T ss_pred EEEEEEEECEEECCCEEEECCCCCCCCEEEEECCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHCCCCCC T ss_conf 34899970643189713657899999879997799997899999999995695100345454469999999861236888 Q ss_pred CEEEEEEEEECCCCHHHHHHHHHCCCCCCCCEEEEEEEECCCCE-----EEEECCEEE Q ss_conf 25899999972897378888874789888838999999438977-----999999884 Q gi|255764514|r 59 EKGQVVAVFEISHLPALEILFAEANLTLEKHVILRRVQFPDGRT-----KAYVNDQVV 111 (554) Q Consensus 59 ~~a~Ve~~F~~~~~~~~~~~~~~~~~~~~~~~iirR~i~~~GkS-----~~~INg~~v 111 (554) ..|.|++.|+..... ....+.++|....++++ ..+.||.+. T Consensus 83 ~~~~v~l~f~~~~~~------------~~~~~~i~R~~~~~~~~~~e~~~v~~~~~~~ 128 (650) T TIGR03185 83 NPARITLTFSVVEGG------------KRHEYTLVRSWHINGKDVKEKFTVYKDDEED 128 (650) T ss_pred CCEEEEEEEEECCCC------------EEEEEEEEEEEEECCCCCCEEEEEEECCCCC T ss_conf 746999999983288------------4899999999973788751058999789663 No 28 >cd03278 ABC_SMC_barmotin Barmotin is a tight junction-associated protein expressed in rat epithelial cells which is thought to have an important regulatory role in tight junction barrier function. Barmotin belongs to the SMC protein family. SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains. Amino-acid sequence homology of SMC proteins between species is largely confined to the amino- and carboxy-terminal globular domains. The amino-terminal domain contains a 'Walker A' nucleotide-binding domain (GxxGxGKS/T, in the single-letter amino-acid code), which by mutational studies has been shown to be essential in several proteins. The carboxy-terminal domain contains a sequence (the DA-box) that resembles a 'Walker B' motif, and a motif with homology to the signature sequence of the ATP-binding cassette (ABC) family of ATPases. The sequence homology within the carboxy-terminal domain is relatively high within the SMC1-SMC4 group, w Probab=99.87 E-value=2.1e-20 Score=153.47 Aligned_cols=78 Identities=33% Similarity=0.415 Sum_probs=73.1 Q ss_pred HHCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCEEEEECHHHHHHHCCCEEEEEE Q ss_conf 406215799999999984366899769980344688879999999999997305939998083798650176179999 Q gi|255764514|r 427 LASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSKKIQLLAVTHAPQVAARADRHFLVYK 504 (554) Q Consensus 427 iaSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~~~Qvi~ITH~pqvAa~a~~h~~v~K 504 (554) .+||||+-|+++|+.+++...+|.|++||||..++++-.+...|-+.|+++++..++|+|||-+-+...||+=|.|.= T Consensus 113 ~LSGGqkQRvAiAr~~A~~~~~p~~iliLDEPTs~LD~~~~~~i~~~l~~l~~~~t~IiITH~~~~i~~AD~Ii~v~m 190 (197) T cd03278 113 LLSGGEKALTALALLFAIFRVRPSPFCVLDEVDAALDDANVERFARLLKEFSKETQFIVITHRKGTMEAADRLYGVTM 190 (197) T ss_pred CCCHHHHHHHHHHHHHHHHHCCCCCEEEECCCCCCCCHHHHHHHHHHHHHHHCCCEEEEEECCHHHHHHCCEEEEEEE T ss_conf 388789999999999999834999789971785538989999999999998569989999849999985899999983 No 29 >cd03276 ABC_SMC6_euk Eukaryotic SMC6 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains. Amino-acid sequence homology of SMC proteins between species is largely confined to the amino- and carboxy-terminal globular domains. The amino-terminal domain contains a 'Walker A' nucleotide-binding domain (GxxGxGKS/T, in the single-letter amino-acid code), which by mutational studies has been shown to be essential in several proteins. The carboxy-terminal domain contains a sequence (the DA-box) that resembles a 'Walker B' motif, and a motif with homology to the signature sequence of the ATP-binding cassette (ABC) family of ATPases. The sequence homology within the carboxy-terminal domain is relatively high within the SMC1-SMC4 group, whereas SMC5 and SMC6 show some divergence in both of these sequences. In eukaryotic cells, the proteins are found as heterodimers of SMC1 paired with SMC3, SMC2 with SMC4, and SMC5 with SMC6 (for Probab=99.87 E-value=5.6e-21 Score=157.26 Aligned_cols=72 Identities=24% Similarity=0.495 Sum_probs=66.4 Q ss_pred CCEEEEECCEEEEEEEEECCCCEEEEECCCCCCHHHHHHHHHHHHCCCCC--------CCCCCCCCCEEEEEEEEECCCC Q ss_conf 92599942278999988738981899889997888999999987147325--------3311289725899999972897 Q gi|255764514|r 1 MTRLSIYNIVLIESLDIDFSAGLSILSGDTGSGKSILLDALILVTGGRGD--------GGLVRRHAEKGQVVAVFEISHL 72 (554) Q Consensus 1 L~~L~i~Nf~~i~~~~i~f~~Gl~vItGetGaGKS~ildAl~~~lG~r~~--------~~~Ir~g~~~a~Ve~~F~~~~~ 72 (554) +++++++||++|++++++|+||+|+|+|+||||||+|++||+++||+++. +++|++|++.|.|+++..+.+. T Consensus 1 I~~I~l~NFm~h~~~~~~f~p~lN~IiG~NGsGKSsIl~AI~lgLGgk~~~~~Rg~s~k~fIK~G~~~A~I~I~L~N~g~ 80 (198) T cd03276 1 IESITLKNFMCHRHLQIEFGPRVNFIVGNNGSGKSAILTALTIGLGGKASDTNRGSSLKDLIKDGESSAKITVTLKNQGL 80 (198) T ss_pred CCEEEEEEECCCCCEEEEECCCEEEEECCCCCCHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHCCCCEEEEEEEEECCCC T ss_conf 94799981335121389608982899889999889999999986388813365313399998678743899999946888 No 30 >COG1195 RecF Recombinational DNA repair ATPase (RecF pathway) [DNA replication, recombination, and repair] Probab=99.84 E-value=1.5e-17 Score=134.67 Aligned_cols=130 Identities=25% Similarity=0.375 Sum_probs=96.4 Q ss_pred CCEEEEECCEEEEEEEEECCCCEEEEECCCCCCHHHHHHHHHHHHCCCC-----CCCCCCCCCCEEEEEEEEECCCCHHH Q ss_conf 9259994227899998873898189988999788899999998714732-----53311289725899999972897378 Q gi|255764514|r 1 MTRLSIYNIVLIESLDIDFSAGLSILSGDTGSGKSILLDALILVTGGRG-----DGGLVRRHAEKGQVVAVFEISHLPAL 75 (554) Q Consensus 1 L~~L~i~Nf~~i~~~~i~f~~Gl~vItGetGaGKS~ildAl~~~lG~r~-----~~~~Ir~g~~~a~Ve~~F~~~~~~~~ 75 (554) |.+|.++||.-+++++|+|+||+|+++|+||+||++||+||.++--+|+ ++++||.|++.+.|.+.+.... T Consensus 3 l~~L~L~nFRNy~~~~l~~~p~~nvl~G~NgqGKTNlLEAI~~l~~grS~Rt~~~~~lir~~~~~~~i~~~v~~~~---- 78 (363) T COG1195 3 LLSLLLRNFRNYAELDLDLSPGVNVLVGENGQGKTNLLEAIYLLALGRSHRTSRDKELIRTGADEAEISARVQRKG---- 78 (363) T ss_pred EEEEEHHHCCCCCCCEECCCCCCEEEECCCCCCHHHHHHHHHHHCCCCCCCCCCHHHHHHCCCCCEEEEEEEEECC---- T ss_conf 0361353317841200036998379989898862899999999712567653014579861886289999996055---- Q ss_pred HHHHHHCCCCCCCCEEEEEEEECCCCEEEEECCEEEE-CHHHHHHHHHHHCCCCCCCHHHHH--HHHHHHHHHHHHH Q ss_conf 8888747898888389999994389779999998841-011222111000001220000000--0367877776630 Q gi|255764514|r 76 EILFAEANLTLEKHVILRRVQFPDGRTKAYVNDQVVS-VNFMRAVGSLLIEIHSQHADRSLL--DVQGHRKILDSYA 149 (554) Q Consensus 76 ~~~~~~~~~~~~~~~iirR~i~~~GkS~~~INg~~v~-~~~L~~l~~~lidi~gQ~e~~~Ll--~~~~q~~lLD~~~ 149 (554) ....+.-.+.+.|+.+.+|||.++. .+.|-...+. |-|.. +...|. .|+.+|.+||... T Consensus 79 ------------~~~~~~~~~~~~g~~~vring~~~~~~~el~g~l~~-vlf~P--edl~Lv~G~P~~RRrFLD~~l 140 (363) T COG1195 79 ------------REGTLGLQISKKGRRRVRINGTKARKLAELAGHLNV-VLFTP--EDLGLVKGSPSDRRRFLDWLL 140 (363) T ss_pred ------------CEEEEEEEECCCCCEEEEECCCCCCCHHHHHHHCCE-EEECC--CCCCCCCCCHHHHHHHHHHHH T ss_conf ------------120157875267635898878224568988611756-99654--643500589788899998887 No 31 >TIGR00618 sbcc exonuclease SbcC; InterPro: IPR004592 All proteins in this family for which functions are known are part of an exonuclease complex with sbcD homologs. This complex is involved in the initiation of recombination to regulate the levels of palindromic sequences in DNA. SbcC may have nuclease activity that is functionally related to one of the nuclease activities of the RecBCD enzyme (IPR004586 from INTERPRO).; GO: 0004527 exonuclease activity, 0006259 DNA metabolic process. Probab=99.74 E-value=8.3e-16 Score=123.14 Aligned_cols=100 Identities=23% Similarity=0.252 Sum_probs=74.8 Q ss_pred CCCCCEEEEECCCCCCCCHHHHHHCCHHHHHHHHHHHHHHCCC------CCCCEEEEECCCCCCCHHHHHHHHHHHHHHH Q ss_conf 5432001101278998311354406215799999999984366------8997699803446888799999999999973 Q gi|255764514|r 405 GIDRVEFYVQTNRGENPGPLMKLASGGELSRFLLALKIVLVDQ------GSIPTLVFDEVDSGIGGAVADAIGYRLKQLS 478 (554) Q Consensus 405 G~d~v~f~~s~n~g~~~~pl~kiaSGGE~Sr~~LAl~~~~~~~------~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls 478 (554) +.+.|...+++ ....+|.. .+||||--++.|||.+++++. .....|+.||===-++-.+.+++-..|-.+. T Consensus 951 ~~~~lv~~~~~--a~~~RP~~-tlSGGE~Fl~slSlaLAladl~~~~~~~~L~sLfiDEGFGslD~~~~d~~~~~L~ai~ 1027 (1063) T TIGR00618 951 LKALLVVEIAT--ADAVRPVE-TLSGGETFLASLSLALALADLLSQRGGTALDSLFIDEGFGSLDEDSLDRAVEILDAIK 1027 (1063) T ss_pred HHHHHHHHHHH--CCCCCCCC-CCCCHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHH T ss_conf 37877652664--37878875-3441799999999999999998630551335543205777777778989999999988 Q ss_pred H-CCCEEEEE-CHHHHHHHCCCEEEEEEEEC Q ss_conf 0-59399980-83798650176179999621 Q gi|255764514|r 479 K-KIQLLAVT-HAPQVAARADRHFLVYKTNK 507 (554) Q Consensus 479 ~-~~Qvi~IT-H~pqvAa~a~~h~~v~K~~~ 507 (554) . ..-+|-|+ |-|+++-+=...+.|.|... T Consensus 1028 ~~~~~~iGv~SHv~~~~er~~~~I~v~K~~~ 1058 (1063) T TIGR00618 1028 EDVAKMIGVISHVPEFRERIPERIKVKKTNA 1058 (1063) T ss_pred HCCCCEEEEECCHHHHHHHCCCCEEEEEECC T ss_conf 4489558654075889742642436665377 No 32 >cd03227 ABC_Class2 ABC-type Class 2 contains systems involved in cellular processes other than transport. These families are characterised by the fact that the ABC subunit is made up of duplicated, fused ABC modules (ABC2). No known transmembrane proteins or domains are associated with these proteins. Probab=99.66 E-value=3.4e-15 Score=119.15 Aligned_cols=79 Identities=28% Similarity=0.375 Sum_probs=69.9 Q ss_pred HCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHH-CCCEEEEECHHHHHHHCCCEEEEEEEE Q ss_conf 0621579999999998436689976998034468887999999999999730-593999808379865017617999962 Q gi|255764514|r 428 ASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSK-KIQLLAVTHAPQVAARADRHFLVYKTN 506 (554) Q Consensus 428 aSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~-~~Qvi~ITH~pqvAa~a~~h~~v~K~~ 506 (554) +||||..|.++|..+..+...+.+++++||+.+|.+-..+..++..+.++.. ..+||++||.|.+++.||+.+.|.+.. T Consensus 78 lSgg~~~~~~l~~~l~~~~~~~~~lillDE~~~Gtd~~~~~~l~~~i~~~~~~~~~~i~tTH~~eL~~lad~~~~~~~~~ 157 (162) T cd03227 78 LSGGEKELSALALILALASLKPRPLYILDEIDRGLDPRDGQALAEAILEHLVKGAQVIVITHLPELAELADKLIHIKKVI 157 (162) T ss_pred CCCCHHHHHHHHHHHHHCCCCCCCEEEECCCCCCCCHHHHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHHHCCEEEEE T ss_conf 05429999999999985424898489963655799988999999999999976998999797399999987500747877 No 33 >cd03277 ABC_SMC5_euk Eukaryotic SMC5 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains. Amino-acid sequence homology of SMC proteins between species is largely confined to the amino- and carboxy-terminal globular domains. The amino-terminal domain contains a 'Walker A' nucleotide-binding domain (GxxGxGKS/T, in the single-letter amino-acid code), which by mutational studies has been shown to be essential in several proteins. The carboxy-terminal domain contains a sequence (the DA-box) that resembles a 'Walker B' motif, and a motif with homology to the signature sequence of the ATP-binding cassette (ABC) family of ATPases. The sequence homology within the carboxy-terminal domain is relatively high within the SMC1-SMC4 group, whereas SMC5 and SMC6 show some divergence in both of these sequences. In eukaryotic cells, the proteins are found as heterodimers of SMC1 paired with SMC3, SMC2 with SMC4, and SMC5 with SMC6 (for Probab=99.64 E-value=6.5e-16 Score=123.87 Aligned_cols=70 Identities=26% Similarity=0.452 Sum_probs=63.3 Q ss_pred CCEEEEECCEEEEEEEEECCCCEEEEECCCCCCHHHHHHHHHHHHCCCC------C--CCCCCCCCCEEEEEEEEECC Q ss_conf 9259994227899998873898189988999788899999998714732------5--33112897258999999728 Q gi|255764514|r 1 MTRLSIYNIVLIESLDIDFSAGLSILSGDTGSGKSILLDALILVTGGRG------D--GGLVRRHAEKGQVVAVFEIS 70 (554) Q Consensus 1 L~~L~i~Nf~~i~~~~i~f~~Gl~vItGetGaGKS~ildAl~~~lG~r~------~--~~~Ir~g~~~a~Ve~~F~~~ 70 (554) +.+++++||+.++.+++.|+|++|+|+||||||||+|+.||+++||++. + .++|++|++++.||++.... T Consensus 3 I~rI~l~NFmty~~~~~~~gp~lN~IiGpNGSGKSsIv~AI~lgLGG~p~~lgRa~~v~~fVK~G~~~~~iEIeL~~~ 80 (213) T cd03277 3 IVRIKLENFVTYDETEFRPGPSLNMIIGPNGSGKSSIVCAICLGLGGKPKLLGRAKKVGEFVKRGCDEGTIEIELYGN 80 (213) T ss_pred EEEEEEEEEECCEEEEEECCCCEEEEECCCCCCHHHHHHHHHHHHCCCHHHCCCHHHHHHHHHCCCCCEEEEEEEECC T ss_conf 899999730011046995499757998899887899999999881898000452656999985787642899999659 No 34 >TIGR00611 recf DNA replication and repair protein RecF; InterPro: IPR001238 All proteins in this family, including recF, for which functions are known are DNA binding proteins that assist the filamentation of RecA onto DNA for the initiation of recombination or recombinational repair. RecF is involved in DNA metabolism and is required for recombinational DNA repair and for induction of the SOS response , . ; GO: 0003697 single-stranded DNA binding, 0005524 ATP binding, 0006281 DNA repair. Probab=99.63 E-value=3.5e-15 Score=119.06 Aligned_cols=153 Identities=21% Similarity=0.270 Sum_probs=98.6 Q ss_pred CCEEE---------EECCEEEEEEEEE---CCCCEE-EEECCCCCCH--HHHHHHHHHHHCCCC-----CCCCCCCCCCE Q ss_conf 92599---------9422789999887---389818-9988999788--899999998714732-----53311289725 Q gi|255764514|r 1 MTRLS---------IYNIVLIESLDID---FSAGLS-ILSGDTGSGK--SILLDALILVTGGRG-----DGGLVRRHAEK 60 (554) Q Consensus 1 L~~L~---------i~Nf~~i~~~~i~---f~~Gl~-vItGetGaGK--S~ildAl~~~lG~r~-----~~~~Ir~g~~~ 60 (554) +.+|. |+||..++.++++ |+|||| +|+|+||+|| ++||+||.++-=+|+ ++.+||+|++. T Consensus 3 ~~~L~rPCrCGCkPl~~FRNy~~v~L~rCvl~p~~Nq~~~G~NgqGKrPTnllEAiy~L~~~rShR~~~~~~lIr~~~~~ 82 (399) T TIGR00611 3 LSRLERPCRCGCKPLKDFRNYDEVDLERCVLSPGVNQVFVGPNGQGKRPTNLLEAIYYLALGRSHRTSRDKELIRFGAEA 82 (399) T ss_pred CCCCCCCCCCCCCCCCCCCCHHHCCCHHHCCCCCCCEEEECCCCCCCCHHHHHHHHHHHHHHHHHHHHCCCCCEECCCCE T ss_conf 30017755567756888778645010020117887448876788986407899999998744435442056301127861 Q ss_pred EEEEEEEECCCCHHHHHHHHHCCCCCCCCEEEEEEEECCCCEE-EEECCEEEECHHHHHHHHHHHCCCCCCCHHHHHH-- Q ss_conf 8999999728973788888747898888389999994389779-9999988410112221110000012200000000-- Q gi|255764514|r 61 GQVVAVFEISHLPALEILFAEANLTLEKHVILRRVQFPDGRTK-AYVNDQVVSVNFMRAVGSLLIEIHSQHADRSLLD-- 137 (554) Q Consensus 61 a~Ve~~F~~~~~~~~~~~~~~~~~~~~~~~iirR~i~~~GkS~-~~INg~~v~~~~L~~l~~~lidi~gQ~e~~~Ll~-- 137 (554) +.|++.+..++. +..+.=++...-|.+ ..||..+.....+.++...|--+-===|...|++ T Consensus 83 ~~~~g~~~~~~~----------------~~~~~l~~~~~~k~~~~~~n~~~~~g~k~~dl~g~L~~~LfaPEdL~Lv~G~ 146 (399) T TIGR00611 83 AVIEGRVSKEDR----------------EVTIDLEILLKKKGKKAKVNILGQDGNKLSDLAGLLPVVLFAPEDLTLVKGS 146 (399) T ss_pred EEEEEEEEECCC----------------EEEEEEEEEEECCCCEEEEEECCCCCCHHHHHHHHCCEEEECCCCCCCCCCC T ss_conf 799999980871----------------7898765873003662587416555530998987412032078872101588 Q ss_pred HHHHHHHHH-HHHCCHHHHHHHHHHHHHHHHHHHH Q ss_conf 367877776-6300001389999999999999988 Q gi|255764514|r 138 VQGHRKILD-SYADIDLSLCELGTLYRHWCCTADA 171 (554) Q Consensus 138 ~~~q~~lLD-~~~~~~~~~~~~~~~~~~~~~~~~~ 171 (554) |..+|.+|| ..+... ...|-..+..|+.+.++ T Consensus 147 P~~RRrFLD~~l~~~~--~~~~~~~~s~y~r~LkQ 179 (399) T TIGR00611 147 PSVRRRFLDWELFQVS--RPVYLSAWSDYQRVLKQ 179 (399) T ss_pred HHHHHHHHHHHHHHHC--CHHHHHHHHHHHHHHHH T ss_conf 6567888315877623--15789999864269998 No 35 >cd03240 ABC_Rad50 The catalytic domains of Rad50 are similar to the ATP-binding cassette of ABC transporters, but are not associated with membrane-spanning domains. The conserved ATP-binding motifs common to Rad50 and the ABC transporter family include the Walker A and Walker B motifs, the Q loop, a histidine residue in the switch region, a D-loop, and a conserved LSGG sequence. This conserved sequence, LSGG, is the most specific and characteristic motif of this family and is thus known as the ABC signature sequence. Probab=99.58 E-value=1.8e-13 Score=107.76 Aligned_cols=75 Identities=24% Similarity=0.338 Sum_probs=60.9 Q ss_pred HCCHHHH------HHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHH-HHHHHHHHHHHCC--CEEEEECHHHHHHHCCC Q ss_conf 0621579------9999999984366899769980344688879999-9999999973059--39998083798650176 Q gi|255764514|r 428 ASGGELS------RFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVAD-AIGYRLKQLSKKI--QLLAVTHAPQVAARADR 498 (554) Q Consensus 428 aSGGE~S------r~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~-~v~~~l~~ls~~~--Qvi~ITH~pqvAa~a~~ 498 (554) +||||+- |++||-.++ .++|+++|||.=+|++-.+.. .+.++++.+.+.. .||+|||-+.++.+||+ T Consensus 116 LSgGqkq~~~l~~RlalAraL~----~~p~lllLDEPTs~LD~~~~~~~l~~ll~~~~~~~~~tiIivtHd~e~~~~aD~ 191 (204) T cd03240 116 CSGGEKVLASLIIRLALAETFG----SNCGILALDEPTTNLDEENIEESLAEIIEERKSQKNFQLIVITHDEELVDAADH 191 (204) T ss_pred CCHHHCCCCHHHHHHHHHHHHH----CCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHCCCCEEEEEECCHHHHHHCCE T ss_conf 7864307230756999999984----599989981876669978999999999999985699899999449899984995 Q ss_pred EEEEEEEE Q ss_conf 17999962 Q gi|255764514|r 499 HFLVYKTN 506 (554) Q Consensus 499 h~~v~K~~ 506 (554) =+.|.|.. T Consensus 192 vv~i~kdG 199 (204) T cd03240 192 IYRVEKDG 199 (204) T ss_pred EEEEECCC T ss_conf 99995898 No 36 >cd00267 ABC_ATPase ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide-binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins. Probab=99.58 E-value=4.5e-13 Score=105.12 Aligned_cols=73 Identities=32% Similarity=0.453 Sum_probs=62.4 Q ss_pred HCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHC-CCEEEEECHHHHHHHCCCEEEEEE Q ss_conf 06215799999999984366899769980344688879999999999997305-939998083798650176179999 Q gi|255764514|r 428 ASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSKK-IQLLAVTHAPQVAARADRHFLVYK 504 (554) Q Consensus 428 aSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~~-~Qvi~ITH~pqvAa~a~~h~~v~K 504 (554) +||||+-|+++|..++. .+|.++|||..+|++-.+...+.++++++.+. ..||+|||-+..+...-.++.+-+ T Consensus 81 LSgGqkqrv~iA~al~~----~p~ililDEPtsgLD~~~~~~l~~~i~~l~~~g~tii~vtH~~~~~~~~~d~v~~~~ 154 (157) T cd00267 81 LSGGQRQRVALARALLL----NPDLLLLDEPTSGLDPASRERLLELLRELAEEGRTVIIVTHDPELAELAADRVIVLK 154 (157) T ss_pred CCHHHHHHHHHHHHHHC----CCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCEEEEEECCHHHHHHHCCEEEEEE T ss_conf 88699999999999970----999999969876689999999999999999689999999089999999799999974 No 37 >KOG0250 consensus Probab=99.50 E-value=1.2e-10 Score=89.11 Aligned_cols=81 Identities=21% Similarity=0.109 Sum_probs=55.0 Q ss_pred CCHHHHHHCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHH--CCCEEEEECHHHHHHHCCC Q ss_conf 31135440621579999999998436689976998034468887999999999999730--5939998083798650176 Q gi|255764514|r 421 PGPLMKLASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSK--KIQLLAVTHAPQVAARADR 498 (554) Q Consensus 421 ~~pl~kiaSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~--~~Qvi~ITH~pqvAa~a~~ 498 (554) ...+ +.+||||.|=.-+||.+++......||..+||-|+.-+-.+-..+-++|-.++. ..|+|.|| ||=-+.=.. T Consensus 984 v~d~-~gLSGGERSFsTv~lllsLW~~me~Pfr~LDEFDVFMD~vNRKi~~dlLv~~a~~~~~Q~IfiT--Pqdi~~l~~ 1060 (1074) T KOG0250 984 VRDT-RGLSGGERSFSTVCLLLSLWEVMECPFRALDEFDVFMDMVNRKISMDLLVDFAKKKGRQFIFIT--PQDISKLNS 1060 (1074) T ss_pred CCCC-CCCCCCCCHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCEEEEEC--CCCHHHHCC T ss_conf 3466-4567663059999999987676328535665788899988889999999999985265079984--530765223 Q ss_pred EEEEEE Q ss_conf 179999 Q gi|255764514|r 499 HFLVYK 504 (554) Q Consensus 499 h~~v~K 504 (554) |..|.+ T Consensus 1061 ~~~i~v 1066 (1074) T KOG0250 1061 DDGIVV 1066 (1074) T ss_pred CCCEEE T ss_conf 446377 No 38 >cd03279 ABC_sbcCD SbcCD and other Mre11/Rad50 (MR) complexes are implicated in the metabolism of DNA ends. They cleave ends sealed by hairpin structures and are thought to play a role in removing protein bound to DNA termini. Probab=99.50 E-value=8.8e-14 Score=109.78 Aligned_cols=71 Identities=28% Similarity=0.445 Sum_probs=60.4 Q ss_pred CCEEEEECCEEE-EEEEEECCC----CEEEEECCCCCCHHHHHHHHHHHHCCCCC--------CCCCCCCCCEEEEEEEE Q ss_conf 925999422789-999887389----81899889997888999999987147325--------33112897258999999 Q gi|255764514|r 1 MTRLSIYNIVLI-ESLDIDFSA----GLSILSGDTGSGKSILLDALILVTGGRGD--------GGLVRRHAEKGQVVAVF 67 (554) Q Consensus 1 L~~L~i~Nf~~i-~~~~i~f~~----Gl~vItGetGaGKS~ildAl~~~lG~r~~--------~~~Ir~g~~~a~Ve~~F 67 (554) +.+|+++||..+ ...+|||.+ |+++|+||||||||+|+|||+|||.++.+ .+.+..|+..+.|+.+| T Consensus 3 ~~~L~l~nF~~y~g~~~IDF~~~~~~~lflI~G~nGsGKSTIlDAI~~aLYGk~~r~~~~~~~~~~~~~ge~~aeV~feF 82 (213) T cd03279 3 PLKLELKNFGPFREEQVIDFTGLDNNGLFLICGPTGAGKSTILDAITYALYGKTPRYGRQENLRSVFAPGEDTAEVSFTF 82 (213) T ss_pred EEEEEEECCCCCCCCEEEECCCCCCCCEEEEECCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCEEEEEEEE T ss_conf 57999977504589717848767878889998899997889999999998388823366410002445678449999999 Q ss_pred ECCC Q ss_conf 7289 Q gi|255764514|r 68 EISH 71 (554) Q Consensus 68 ~~~~ 71 (554) .+.+ T Consensus 83 ~~g~ 86 (213) T cd03279 83 QLGG 86 (213) T ss_pred EECC T ss_conf 9778 No 39 >COG3950 Predicted ATP-binding protein involved in virulence [General function prediction only] Probab=99.44 E-value=1.8e-11 Score=94.64 Aligned_cols=47 Identities=32% Similarity=0.518 Sum_probs=44.1 Q ss_pred CCEEEEECCEEEEEEEEECCCC-EEEEECCCCCCHHHHHHHHHHHHCC Q ss_conf 9259994227899998873898-1899889997888999999987147 Q gi|255764514|r 1 MTRLSIYNIVLIESLDIDFSAG-LSILSGDTGSGKSILLDALILVTGG 47 (554) Q Consensus 1 L~~L~i~Nf~~i~~~~i~f~~G-l~vItGetGaGKS~ildAl~~~lG~ 47 (554) |.+|++-||.+|.+++|.|+++ .|+|+||||||||++||||..+|.- T Consensus 3 LrkiSl~nfr~f~~lditf~e~~ttIivgpNGsGKTtvLdair~aL~~ 50 (440) T COG3950 3 LRKISLNNFRCFLNLDITFGESETTIIVGPNGSGKTTVLDAIRNALNK 50 (440) T ss_pred CCHHHHHHHHHHHHCEEECCCCCEEEEECCCCCCHHHHHHHHHHHHHH T ss_conf 101004432134300254179733899878998701599999999876 No 40 >PRK10246 exonuclease subunit SbcC; Provisional Probab=99.36 E-value=6.8e-08 Score=70.97 Aligned_cols=73 Identities=29% Similarity=0.414 Sum_probs=62.9 Q ss_pred CEEEEECCEEEE-EEEEECC------CCEEEEECCCCCCHHHHHHHHHHHHCCCCC---------CCCCCCCCCEEEEEE Q ss_conf 259994227899-9988738------981899889997888999999987147325---------331128972589999 Q gi|255764514|r 2 TRLSIYNIVLIE-SLDIDFS------AGLSILSGDTGSGKSILLDALILVTGGRGD---------GGLVRRHAEKGQVVA 65 (554) Q Consensus 2 ~~L~i~Nf~~i~-~~~i~f~------~Gl~vItGetGaGKS~ildAl~~~lG~r~~---------~~~Ir~g~~~a~Ve~ 65 (554) .+|+|+||.+|. ..+|||+ .||.+|+||||||||+|||||||+|.|+++ .+++++|...+.|++ T Consensus 4 l~L~l~~fgsy~~~~~IDFt~~~l~~~gLFlI~G~TGAGKSTIlDAItfALYG~~~r~~~~~~~~~~~~~~~~~~~~Vel 83 (1047) T PRK10246 4 LSLRLKNLNSLKGEWKIDFTAEPFASNGLFAITGPTGAGKTTLLDAICLALYHETPRLNNVSQSQNDLMTRDTAECLAEV 83 (1047) T ss_pred EEEEEECCCCCCCCEEEECCCCCCCCCCEEEEECCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHCCCCCCEEEEE T ss_conf 59998550178898467489864566887888899999889999999999589988888877560556228999668999 Q ss_pred EEECCCCHH Q ss_conf 997289737 Q gi|255764514|r 66 VFEISHLPA 74 (554) Q Consensus 66 ~F~~~~~~~ 74 (554) +|.+.+..+ T Consensus 84 ~F~~~g~~Y 92 (1047) T PRK10246 84 EFEVKGEAY 92 (1047) T ss_pred EEEECCEEE T ss_conf 999999899 No 41 >KOG0962 consensus Probab=99.26 E-value=8.9e-09 Score=76.80 Aligned_cols=70 Identities=26% Similarity=0.434 Sum_probs=47.9 Q ss_pred CEEEEECCEEEE---EEEEECCCCEEEEECCCCCCHHHHHHHHHHHHCCCCC-----CCCCCC----C--CCEEEEEEEE Q ss_conf 259994227899---9988738981899889997888999999987147325-----331128----9--7258999999 Q gi|255764514|r 2 TRLSIYNIVLIE---SLDIDFSAGLSILSGDTGSGKSILLDALILVTGGRGD-----GGLVRR----H--AEKGQVVAVF 67 (554) Q Consensus 2 ~~L~i~Nf~~i~---~~~i~f~~Gl~vItGetGaGKS~ildAl~~~lG~r~~-----~~~Ir~----g--~~~a~Ve~~F 67 (554) .+|+|+.+.+|+ .-.|+|.+-+|.|+|+||+||++|+.++.++.-|-.. ..||.. | .-.|.|...| T Consensus 5 ~klsI~GIRSf~~~d~~~i~F~sPlTLIvG~NG~GKTTiIEcLKyatTG~lPpnsk~~~FiHdpkIage~ev~AqvkL~f 84 (1294) T KOG0962 5 DKLSIRGIRSFDDKDRNTIEFFSPLTLIVGANGTGKTTIIECLKYATTGELPPNSKGGSFIHDPKVAGETEVRAQVKLAF 84 (1294) T ss_pred HHHHHHCCCCCCCCCCCEEEECCCEEEEECCCCCCCHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCHHHHHHEEEEEE T ss_conf 75676210146876655365117705676688877166999988886484899876777778952103144420347633 Q ss_pred ECCC Q ss_conf 7289 Q gi|255764514|r 68 EISH 71 (554) Q Consensus 68 ~~~~ 71 (554) ...+ T Consensus 85 ~~~~ 88 (1294) T KOG0962 85 TDVN 88 (1294) T ss_pred ECCC T ss_conf 0378 No 42 >COG4717 Uncharacterized conserved protein [Function unknown] Probab=99.20 E-value=3.9e-08 Score=72.55 Aligned_cols=80 Identities=20% Similarity=0.245 Sum_probs=59.0 Q ss_pred EEEECCCCCCCCHHHHHHCCHHHHHHHHHHHHHHCC----CCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCEEEE Q ss_conf 110127899831135440621579999999998436----6899769980344688879999999999997305939998 Q gi|255764514|r 411 FYVQTNRGENPGPLMKLASGGELSRFLLALKIVLVD----QGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSKKIQLLAV 486 (554) Q Consensus 411 f~~s~n~g~~~~pl~kiaSGGE~Sr~~LAl~~~~~~----~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~~~Qvi~I 486 (554) +++..-.|...-|- =+|-|-+--+-|||.|++.. ..|.| +|||-|=++-+-+-+.++=++|+.||...|||-- T Consensus 887 I~V~~~~G~~~~~~--ELSqgT~EQLYlAlRfali~~~~~~~~LP-~i~DD~fVhFD~~R~~r~~e~l~dls~~~QviYF 963 (984) T COG4717 887 IIVEHRAGGSKLAE--ELSQGTKEQLYLALRFALIHEVRTREPLP-FIADDIFVHFDDERAKRMLELLADLSEGNQVIYF 963 (984) T ss_pred EEEEECCCCCCCHH--HHHHHHHHHHHHHHHHHHHHHHCCCCCCC-EEECCCHHCCCHHHHHHHHHHHHHHCCCCEEEEE T ss_conf 58872365523589--88365799999999998886313578887-5632300005888999999999973557807999 Q ss_pred ECHHHHH Q ss_conf 0837986 Q gi|255764514|r 487 THAPQVA 493 (554) Q Consensus 487 TH~pqvA 493 (554) ||-|.+. T Consensus 964 TCHe~~~ 970 (984) T COG4717 964 TCHEHTC 970 (984) T ss_pred EECHHHH T ss_conf 7036654 No 43 >pfam12128 DUF3584 Protein of unknown function (DUF3584). This protein is found in bacteria and eukaryotes. Proteins in this family are typically between 943 to 1234 amino acids in length. There are two conserved sequence motifs: GKT and YLP. Probab=99.18 E-value=1.9e-08 Score=74.60 Aligned_cols=33 Identities=24% Similarity=0.432 Sum_probs=28.7 Q ss_pred EEEECCCCEEEEECCCCCCHHHHHHHHHHHHCCC Q ss_conf 9887389818998899978889999999871473 Q gi|255764514|r 15 LDIDFSAGLSILSGDTGSGKSILLDALILVTGGR 48 (554) Q Consensus 15 ~~i~f~~Gl~vItGetGaGKS~ildAl~~~lG~r 48 (554) .+|+++ |=|-|+|-||+|||+++.||.|-.|.. T Consensus 12 aEl~ld-Gnt~~~GTnG~GKTTlLRlIp~FYga~ 44 (1192) T pfam12128 12 NELDLD-GHTNICGTNAAGKTTLQRLIPLFYGEY 44 (1192) T ss_pred EEEECC-CCEEEECCCCCCHHHHHHHHHHHCCCC T ss_conf 577337-872574488886999998999752897 No 44 >TIGR00606 rad50 rad50; InterPro: IPR004584 Rad50 is involved in recombination, recombinational repair, and/or non-homologous end joining. It is a component of an exonuclease complex with MRE11 homologs. The Saccharomyces cerevisiae Rad50/MRE11 complex possesses single-stranded endonuclease activity and ATP-dependent double-strand-specific exonuclease activity. Rad50 provides an ATP-dependent control of MRE11 by unwinding and repositioning DNA ends into the MRE11 active site. This family is distantly related to the SbcC family of bacterial proteins. When the N- and C-terminal globular regions of Rad50 from Pyrococcus furiosus P58301 from SWISSPROT are co-expressed in Escherichia coli, they spontaneously associate to form a stable complex that possesses ATP-binding and weak ATP-hydrolysing activities. The structure formed is known as the Rad50 catalytic domain (Rad50cd1). In the presence of ATP, two Rad50cd1 molecules interact via their ATP-binding and highly conserved 'signature' motifs to form a dimer. As ATP is buried deep within this dimer interface, the two Rad50cd1 molecules may have to completely disengage after ATP hydrolysis to allow the release of ADP before binding of a new ATP molecule. ATP binding is also accompanied by a 30° rotation of two distinct domains within each Rad50cd1 part of the dimer. This rotation and dimerisation creates a positively charged surface which, potentially, could provide a DNA-binding site capable of accommodating two DNA molecules. The Mre11-docking site within Rad50 has been mapped to two 40-residue heptad-repeat sequences that lie adjacent to the N- and C-terminal ATPase segments. A distinct region within this domain forms a conserved hydrophobic patch that is believed to be the actual Mre11-binding site and lies immediately adjacent to the putative DNA-binding site of Rad50. As Rad50 dimerises in the presence of ATP and forms a stoichiometric complex with Mre11 (one Mre11 subunit binding to one Rad50 subunit), it is possible that the MR complex forms a closely coordinated DNA-binding unit that has the potential to act on two DNA molecules simultaneously. Within this unit, ATP-dependent control of nuclease action might be achieved via Rad50 unwinding or repositioning DNA ends into the active-site of Mre11 . ; GO: 0005524 ATP binding, 0006281 DNA repair, 0030870 Mre11 complex. Probab=99.14 E-value=1.6e-07 Score=68.61 Aligned_cols=67 Identities=31% Similarity=0.458 Sum_probs=47.0 Q ss_pred CEEEEECCEEE-----EEEEEECCCCEEEEECCCCCCHHHHHHHHHHHHCCCCC-----CCCCCCC------CCEEEEEE Q ss_conf 25999422789-----99988738981899889997888999999987147325-----3311289------72589999 Q gi|255764514|r 2 TRLSIYNIVLI-----ESLDIDFSAGLSILSGDTGSGKSILLDALILVTGGRGD-----GGLVRRH------AEKGQVVA 65 (554) Q Consensus 2 ~~L~i~Nf~~i-----~~~~i~f~~Gl~vItGetGaGKS~ildAl~~~lG~r~~-----~~~Ir~g------~~~a~Ve~ 65 (554) .+|+|..+.++ |..-|+|-+-+|+|+|||||||+++|+||.|+.-|... ..||... .=.|.|.+ T Consensus 4 ~~l~I~GvRS~G~ED~D~~~I~F~SP~T~l~GPNG~GKTT~IE~L~y~~TG~~P~~~K~NtFvH~~~VA~~T~V~A~~~L 83 (1328) T TIGR00606 4 LKLSILGVRSVGIEDKDKQIIDFLSPLTLLVGPNGAGKTTIIEALKYVTTGDFPPGKKGNTFVHDPKVARETDVRAQVRL 83 (1328) T ss_pred CCEEEEEEEECCCCCCCCCEEEEECCCCEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCCCCCCCCHHHHCCCCEEEEEE T ss_conf 20144332202645444423321166010127788752589875433204889888888600037222110532058899 Q ss_pred EEE Q ss_conf 997 Q gi|255764514|r 66 VFE 68 (554) Q Consensus 66 ~F~ 68 (554) .|. T Consensus 84 ~F~ 86 (1328) T TIGR00606 84 EFR 86 (1328) T ss_pred EEE T ss_conf 888 No 45 >COG3593 Predicted ATP-dependent endonuclease of the OLD family [DNA replication, recombination, and repair] Probab=98.96 E-value=1.4e-09 Score=82.20 Aligned_cols=49 Identities=41% Similarity=0.622 Sum_probs=46.4 Q ss_pred CCEEEEECCEEEEEEEEECCCCEEEEECCCCCCHHHHHHHHHHHHCCCC Q ss_conf 9259994227899998873898189988999788899999998714732 Q gi|255764514|r 1 MTRLSIYNIVLIESLDIDFSAGLSILSGDTGSGKSILLDALILVTGGRG 49 (554) Q Consensus 1 L~~L~i~Nf~~i~~~~i~f~~Gl~vItGetGaGKS~ildAl~~~lG~r~ 49 (554) |.+++|+||..|.++++.|..|+||++|+|-+|||+|||||+++|+..+ T Consensus 3 L~~v~I~nFR~i~~lsl~~~~g~~vlIGeN~~GKsslLdAL~l~l~~~~ 51 (581) T COG3593 3 LERVKIKNFRGINRLSLEFEEGLNVLIGENNSGKSSLLDALRLLLDPES 51 (581) T ss_pred CEEEEECCCCEEEEEEEEECCCCEEEECCCCCCHHHHHHHHHHHCCCCC T ss_conf 2067862500154210454578437976787552789999999708765 No 46 >PRK04863 mukB cell division protein MukB; Provisional Probab=98.92 E-value=6.9e-06 Score=57.77 Aligned_cols=45 Identities=24% Similarity=0.335 Sum_probs=39.3 Q ss_pred CCEEEEECCEEEEEEEEECCCCEEEEECCCCCCHHHHHHHHHHHH Q ss_conf 925999422789999887389818998899978889999999871 Q gi|255764514|r 1 MTRLSIYNIVLIESLDIDFSAGLSILSGDTGSGKSILLDALILVT 45 (554) Q Consensus 1 L~~L~i~Nf~~i~~~~i~f~~Gl~vItGetGaGKS~ildAl~~~l 45 (554) ..+|++-|+-.|=--+++++.-.|.+.|.||||||++|.|.-++| T Consensus 7 ~rSLtLVNwNGffARTfdLd~lVttLsGgNGAGKSTtMaAf~taL 51 (1486) T PRK04863 7 FRSLTLVNWNGFFARTFDLDELVTTLSGGNGAGKSTTMAAFVTAL 51 (1486) T ss_pred CCEEEEEEECCEEEEEEECCCCEEEEECCCCCCHHHHHHHHHHHH T ss_conf 232467634353101310244203300588865798999999996 No 47 >COG1106 Predicted ATPases [General function prediction only] Probab=98.82 E-value=2.1e-09 Score=80.89 Aligned_cols=47 Identities=30% Similarity=0.484 Sum_probs=42.7 Q ss_pred CCEEEEECCEEEEEEEEECCCCEEEEECCCCCCHHHHHHHHHHHHCC Q ss_conf 92599942278999988738981899889997888999999987147 Q gi|255764514|r 1 MTRLSIYNIVLIESLDIDFSAGLSILSGDTGSGKSILLDALILVTGG 47 (554) Q Consensus 1 L~~L~i~Nf~~i~~~~i~f~~Gl~vItGetGaGKS~ildAl~~~lG~ 47 (554) |.+++|+||.++++..++=-.++|+|+|+||||||++++|+.|..|- T Consensus 2 I~~~~IkNFkSf~e~~~~~~~~in~I~G~N~sGKSNlleAl~f~~~~ 48 (371) T COG1106 2 IKSFKIKNFKSFRELELEDFGKINIIYGANGAGKSNLLEALYFLKGL 48 (371) T ss_pred CEEEEECCCCCHHHHHHCCCCCEEEEECCCCCCHHHHHHHHHHHHHH T ss_conf 24899535355877422045426999867887606999999999973 No 48 >COG5293 Predicted ATPase [General function prediction only] Probab=98.77 E-value=2.2e-05 Score=54.42 Aligned_cols=38 Identities=32% Similarity=0.565 Sum_probs=33.0 Q ss_pred EEECCCCEEEEECC-----------CCCCHHHHHHHHHHHHCCCCCCCC Q ss_conf 88738981899889-----------997888999999987147325331 Q gi|255764514|r 16 DIDFSAGLSILSGD-----------TGSGKSILLDALILVTGGRGDGGL 53 (554) Q Consensus 16 ~i~f~~Gl~vItGe-----------tGaGKS~ildAl~~~lG~r~~~~~ 53 (554) .+.|.||+|+|-|+ ||-|||+++.-|.||||+.-+..+ T Consensus 20 ~vkFnpGlNIVlae~red~~~~~~tnglGKSTlie~i~Fclg~ti~rNl 68 (591) T COG5293 20 PVKFNPGLNIVLAEIREDENRKKDTNGLGKSTLIELIDFCLGSTIDRNL 68 (591) T ss_pred EEEECCCCEEEEEECCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCCHH T ss_conf 0420798348852113765543224685466699999998445010105 No 49 >cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome. The peroxisomal membrane forms a permeability barrier for a wide variety of metabolites required for and formed during fatty acid beta-oxidation. To communicate with the cytoplasm and mitochondria, peroxisomes need dedicated proteins to transport such hydrophilic molecules across their membranes. X-linked adrenoleukodystrophy (X-ALD) is caused by mutations in the ALD gene, which encodes ALDP (adrenoleukodystrophy protein ), a peroxisomal integral membrane protein that is a member of the ATP-binding cassette (ABC) transporter protein family. The disease is characterized by a striking and unpredictable variation in phenotypic expression. Phenotypes include the rapidly progressive childhood cerebral form (CCALD), the milder adult form, adrenomyeloneuropathy (AMN), and variants without neurologic involvement (i.e. asympt Probab=98.74 E-value=5.6e-08 Score=71.53 Aligned_cols=71 Identities=27% Similarity=0.333 Sum_probs=61.9 Q ss_pred HCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCEEEEECHHHHHHHCCCEEEEEE Q ss_conf 06215799999999984366899769980344688879999999999997305939998083798650176179999 Q gi|255764514|r 428 ASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSKKIQLLAVTHAPQVAARADRHFLVYK 504 (554) Q Consensus 428 aSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~~~Qvi~ITH~pqvAa~a~~h~~v~K 504 (554) +||||+-|++||-.++ ..++.+|+||.-++++-.+...+-+.|++.+ .=+|+|||-|.+.++||+-+.... T Consensus 92 LSGGqkQRvalARal~----~~p~iliLDEpTs~LD~~~~~~l~~~l~~~~--~Tvi~VtH~~~~~~~aDrvl~Ldg 162 (166) T cd03223 92 LSGGEQQRLAFARLLL----HKPKFVFLDEATSALDEESEDRLYQLLKELG--ITVISVGHRPSLWKFHDRVLDLDG 162 (166) T ss_pred CCHHHHHHHHHHHHHH----CCCCEEEECCCCCCCCHHHHHHHHHHHHHCC--CEEEEEECCHHHHHCCCEEEEEEC T ss_conf 8999999999999996----4999999758533289999999999999779--989999434699972999999918 No 50 >TIGR00618 sbcc exonuclease SbcC; InterPro: IPR004592 All proteins in this family for which functions are known are part of an exonuclease complex with sbcD homologs. This complex is involved in the initiation of recombination to regulate the levels of palindromic sequences in DNA. SbcC may have nuclease activity that is functionally related to one of the nuclease activities of the RecBCD enzyme (IPR004586 from INTERPRO).; GO: 0004527 exonuclease activity, 0006259 DNA metabolic process. Probab=98.74 E-value=1.9e-05 Score=54.84 Aligned_cols=77 Identities=27% Similarity=0.364 Sum_probs=60.2 Q ss_pred CEEEEECCEEEEEEE-EECCC------CEEEEECCCCCCHHHHHHHHHHHHCCC-CC---------CCCCCCCCCEEEEE Q ss_conf 259994227899998-87389------818998899978889999999871473-25---------33112897258999 Q gi|255764514|r 2 TRLSIYNIVLIESLD-IDFSA------GLSILSGDTGSGKSILLDALILVTGGR-GD---------GGLVRRHAEKGQVV 64 (554) Q Consensus 2 ~~L~i~Nf~~i~~~~-i~f~~------Gl~vItGetGaGKS~ildAl~~~lG~r-~~---------~~~Ir~g~~~a~Ve 64 (554) .+|.++||.+|.+.. |||.+ ++.+|+|+||||||+|||||+|+|.|+ .. .++.+..+..|.++ T Consensus 4 l~L~lkn~~~y~~~~~~dfT~~~fasl~~f~i~G~tGAGKtsLldAI~yALYGkP~~~~s~~~~~~~~~~~~~~~~~~~~ 83 (1063) T TIGR00618 4 LKLELKNFTSYKGESVIDFTALGFASLKLFVICGKTGAGKTSLLDAITYALYGKPVPRESEVVASKNSLSRADSEEALAE 83 (1063) T ss_pred CEEEECCCCCCCCCCEEECCCCCCCCCCEEEEECCCCCCHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHHHHH T ss_conf 34764063534576101027887212573677788998354599999998728887751467888754200107877654 Q ss_pred EEEECCCCHHHHHH Q ss_conf 99972897378888 Q gi|255764514|r 65 AVFEISHLPALEIL 78 (554) Q Consensus 65 ~~F~~~~~~~~~~~ 78 (554) +.|.++...+...| T Consensus 84 lef~~~~~~yR~~r 97 (1063) T TIGR00618 84 LEFALDTKLYRVFR 97 (1063) T ss_pred HHHEECCCHHHHHH T ss_conf 64013560114677 No 51 >PRK10535 macrolide transporter ATP-binding /permease protein; Provisional Probab=98.74 E-value=8.2e-08 Score=70.44 Aligned_cols=34 Identities=29% Similarity=0.546 Sum_probs=29.0 Q ss_pred EEEEEEEEECCCC-EEEEECCCCCCHHHHHHHHHH Q ss_conf 7899998873898-189988999788899999998 Q gi|255764514|r 10 VLIESLDIDFSAG-LSILSGDTGSGKSILLDALIL 43 (554) Q Consensus 10 ~~i~~~~i~f~~G-l~vItGetGaGKS~ildAl~~ 43 (554) ...+++++++.+| +.+|.||||||||+++..|+- T Consensus 22 ~~L~~vsl~i~~Ge~v~i~G~nGsGKSTll~~l~g 56 (648) T PRK10535 22 EVLKDISLTIYAGEMVAIVGASGSGKSTLMNILGC 56 (648) T ss_pred EEEECEEEEECCCCEEEEECCCCCHHHHHHHHHHC T ss_conf 98526699998998999999999629999999956 No 52 >cd03245 ABCC_bacteriocin_exporters ABC-type bacteriocin exporters. Many non-lantibiotic bacteriocins of lactic acid bacteria are produced as precursors which have N-terminal leader peptides that share similarities in amino acid sequence and contain a conserved processing site of two glycine residues in positions -1 and -2. A dedicated ATP-binding cassette (ABC) transporter is responsible for the proteolytic cleavage of the leader peptides and subsequent translocation of the bacteriocins across the cytoplasmic membrane. Probab=98.73 E-value=1e-07 Score=69.76 Aligned_cols=73 Identities=27% Similarity=0.398 Sum_probs=64.5 Q ss_pred HCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCEEEEECHHHHHHHCCCEEEEEE Q ss_conf 06215799999999984366899769980344688879999999999997305939998083798650176179999 Q gi|255764514|r 428 ASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSKKIQLLAVTHAPQVAARADRHFLVYK 504 (554) Q Consensus 428 aSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~~~Qvi~ITH~pqvAa~a~~h~~v~K 504 (554) +||||+-|++||=.++ .+++.+||||.-++++..+...+-+.|+++.++.-||+|||-+.+...||+=++..+ T Consensus 141 LSgGqkQri~lARal~----~~~~ililDEpts~LD~~~~~~i~~~l~~~~~~~Tvi~itH~~~~~~~~D~Iivl~~ 213 (220) T cd03245 141 LSGGQRQAVALARALL----NDPPILLLDEPTSAMDMNSEERLKERLRQLLGDKTLIIITHRPSLLDLVDRIIVMDS 213 (220) T ss_pred ECHHHHHHHHHHHHHH----CCCCEEEEECCCCCCCHHHHHHHHHHHHHHCCCCEEEEEECCHHHHHHCCEEEEEEC T ss_conf 1899999999999995----599999996875688989999999999987699989999359889984999999989 No 53 >COG4637 Predicted ATPase [General function prediction only] Probab=98.73 E-value=3.3e-09 Score=79.64 Aligned_cols=99 Identities=25% Similarity=0.374 Sum_probs=79.3 Q ss_pred CCCCCCCCCEEEEECCCCCCCCHHHHHHCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHC Q ss_conf 34465432001101278998311354406215799999999984366899769980344688879999999999997305 Q gi|255764514|r 401 ISPDGIDRVEFYVQTNRGENPGPLMKLASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSKK 480 (554) Q Consensus 401 ~~~~G~d~v~f~~s~n~g~~~~pl~kiaSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~~ 480 (554) +...| .+++.|.- ||...-+...-+|-|-+- +||+..++....+.|++++||-.+++--...-.+|.++++-|++ T Consensus 247 P~~~g--~~~l~~~d-~~~~~P~~~~eLSDGTlR--fl~l~t~Llsp~~p~ll~ldEPE~sLHP~lL~~La~~~~sAak~ 321 (373) T COG4637 247 PGEDG--RIELKWQD-RGFLDPFRDRELSDGTLR--FLALATLLLSPRPPPLLLLDEPETSLHPDLLPALAELMRSAAKR 321 (373) T ss_pred CCCCC--EEEEEECC-CCCCCCHHHHHCCCCHHH--HHHHHHHHCCCCCCCEEEECCCCCCCCHHHHHHHHHHHHHHHCC T ss_conf 87672--58999616-666675044203533899--99999998399999626745852335876999999999986205 Q ss_pred CCEEEEECHHHHHHHCCCEEEEEE Q ss_conf 939998083798650176179999 Q gi|255764514|r 481 IQLLAVTHAPQVAARADRHFLVYK 504 (554) Q Consensus 481 ~Qvi~ITH~pqvAa~a~~h~~v~K 504 (554) .||||+||+|-.++.=.-|=.+.- T Consensus 322 sQv~VsTHS~rLl~~~e~~~v~~~ 345 (373) T COG4637 322 SQVIVSTHSPRLLNAVEEHSVFWL 345 (373) T ss_pred CEEEEEECCHHHHHHCCCCCEEEE T ss_conf 518998277999953563645886 No 54 >cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export. They belong to the subfamily C of the ATP-binding cassette (ABC) superfamily of transport proteins. The ABCC subfamily contains transporters with a diverse functional spectrum that includes ion transport, cell surface receptor, and toxin secretion activities. The MRP-like family, simlar to all ABC proteins, have a common four-domain core structure constituted by two membrane-spanning domains, each composed of six transmembrane (TM) helices, and two nucleotide-binding domains (NBD). ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins. Probab=98.72 E-value=1e-07 Score=69.90 Aligned_cols=72 Identities=25% Similarity=0.366 Sum_probs=63.9 Q ss_pred HCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCEEEEECHHHHHHHCCCEEEEE Q ss_conf 0621579999999998436689976998034468887999999999999730593999808379865017617999 Q gi|255764514|r 428 ASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSKKIQLLAVTHAPQVAARADRHFLVY 503 (554) Q Consensus 428 aSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~~~Qvi~ITH~pqvAa~a~~h~~v~ 503 (554) +||||+-|++||=.++ .+++.+||||.-++++..+...+-+.|+++.+..=+|+|||-+..+..+|+-+... T Consensus 97 LSgGq~Qri~lARal~----~~p~illlDEpts~LD~~~~~~i~~~l~~~~~~~Tvi~vtH~~~~~~~~D~v~~l~ 168 (171) T cd03228 97 LSGGQRQRIAIARALL----RDPPILILDEATSALDPETEALILEALRALAKGKTVIVIAHRLSTIRDADRIIVLD 168 (171) T ss_pred CCHHHHHHHHHHHHHH----HCCCEEEEECCCCCCCHHHHHHHHHHHHHHCCCCEEEEEECCHHHHHHCCEEEEEE T ss_conf 4488999999999997----48998999577667998999999999999809998999957999997099999981 No 55 >cd03254 ABCC_Glucan_exporter_like Glucan exporter ATP-binding protein. In A. tumefaciens cyclic beta-1, 2-glucan must be transported into the periplasmic space to exert its action as a virluence factor. This subfamily belongs to the MRP-like family and is involved in drug, peptide, and lipid export. The MRP-like family, similar to all ABC proteins, have a common four-domain core structure constituted by two membrane-spanning domains each composed of six transmembrane (TM) helices and two nucleotide-binding domains (NBD). ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins. Probab=98.69 E-value=1.6e-07 Score=68.46 Aligned_cols=73 Identities=22% Similarity=0.264 Sum_probs=64.5 Q ss_pred HCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCEEEEECHHHHHHHCCCEEEEEE Q ss_conf 06215799999999984366899769980344688879999999999997305939998083798650176179999 Q gi|255764514|r 428 ASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSKKIQLLAVTHAPQVAARADRHFLVYK 504 (554) Q Consensus 428 aSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~~~Qvi~ITH~pqvAa~a~~h~~v~K 504 (554) +|||++-|++||=.++ ..+|.+||||.-++++-.+...|-+.|+++.++.=+|+|||-+.++..+|+=+++.+ T Consensus 140 LSgGq~Qri~lARal~----~~~~illlDEpts~LD~~t~~~i~~~l~~~~~~~TvI~itH~~~~~~~~D~iivl~~ 212 (229) T cd03254 140 LSQGERQLLAIARAML----RDPKILILDEATSNIDTETEKLIQEALEKLMKGRTSIIIAHRLSTIKNADKILVLDD 212 (229) T ss_pred CCHHHHHHHHHHHHHH----CCCCEEEEECCCCCCCHHHHHHHHHHHHHHCCCCEEEEEECCHHHHHHCCEEEEEEC T ss_conf 9999999999999995----189989998977789989999999999998099889999269889985999999989 No 56 >cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion. Recognition and cleavage of the damaged DNA is a multistep ATP-dependent reaction that requires the UvrA, UvrB, and UvrC proteins. Both UvrA and UvrB are ATPases, with UvrA having two ATP binding sites, which have the characteristic signature of the family of ABC proteins, and UvrB having one ATP binding site that is structurally related to that of helicases. Probab=98.68 E-value=2.3e-07 Score=67.54 Aligned_cols=76 Identities=22% Similarity=0.233 Sum_probs=62.7 Q ss_pred HCCHHHHHHHHHHHHHHCCCCCCC-EEEEECCCCCCCHHHHHHHHHHHHHHHH-CCCEEEEECHHHHHHHCCCEEEEEEE Q ss_conf 062157999999999843668997-6998034468887999999999999730-59399980837986501761799996 Q gi|255764514|r 428 ASGGELSRFLLALKIVLVDQGSIP-TLVFDEVDSGIGGAVADAIGYRLKQLSK-KIQLLAVTHAPQVAARADRHFLVYKT 505 (554) Q Consensus 428 aSGGE~Sr~~LAl~~~~~~~~~~p-~~ifDEiDagi~G~~a~~v~~~l~~ls~-~~Qvi~ITH~pqvAa~a~~h~~v~K~ 505 (554) +||||+=|+++|-.++. +|.| .+||||.-+|++-.+...+-+.|+++.+ .+-||+|||-|.++..||+=+...+- T Consensus 88 LSGGqkQRvaiAraL~~---~p~~~ililDEPtsgLD~~~~~~l~~~l~~l~~~g~TvI~vtHd~~~~~~aDrii~l~~G 164 (176) T cd03238 88 LSGGELQRVKLASELFS---EPPGTLFILDEPSTGLHQQDINQLLEVIKGLIDLGNTVILIEHNLDVLSSADWIIDFGPG 164 (176) T ss_pred CCHHHHHHHHHHHHHHH---CCCCCEEEECCCCCCCCHHHHHHHHHHHHHHHHCCCEEEEEECCHHHHHHCCEEEEECCC T ss_conf 89999999999999986---899868997177445898799999999999998799899994787999839999994599 Q ss_pred E Q ss_conf 2 Q gi|255764514|r 506 N 506 (554) Q Consensus 506 ~ 506 (554) . T Consensus 165 ~ 165 (176) T cd03238 165 S 165 (176) T ss_pred C T ss_conf 7 No 57 >PRK10789 putative multidrug transporter membrane\ATP-binding components; Provisional Probab=98.66 E-value=2.6e-07 Score=67.16 Aligned_cols=73 Identities=19% Similarity=0.274 Sum_probs=66.1 Q ss_pred HCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCEEEEECHHHHHHHCCCEEEEEE Q ss_conf 06215799999999984366899769980344688879999999999997305939998083798650176179999 Q gi|255764514|r 428 ASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSKKIQLLAVTHAPQVAARADRHFLVYK 504 (554) Q Consensus 428 aSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~~~Qvi~ITH~pqvAa~a~~h~~v~K 504 (554) +||||+-|++||=.++ .++|.+||||.-|+++..|-..|-+.|+++.+++=+|+|||-+.....||.=++..+ T Consensus 452 LSGGQrQRialARAll----~~p~iliLDEaTSaLD~~tE~~i~~~l~~~~~~~T~i~IaHRlsti~~aD~I~vl~~ 524 (569) T PRK10789 452 LSGGQKQRISIARALL----LNAEILILDDALSAVDGRTEHQILHNLRQWGEGRTVIISAHRLSALTEASEIIVMQH 524 (569) T ss_pred CCHHHHHHHHHHHHHH----CCCCEEEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCHHHHHHCCEEEEEEC T ss_conf 6999999999999995----499989980876668999999999999997499989997158888985998999989 No 58 >cd03251 ABCC_MsbA MsbA is an essential ABC transporter, closely related to eukaryotic MDR proteins. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins. Probab=98.64 E-value=4e-07 Score=65.93 Aligned_cols=73 Identities=23% Similarity=0.355 Sum_probs=64.9 Q ss_pred HCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCEEEEECHHHHHHHCCCEEEEEE Q ss_conf 06215799999999984366899769980344688879999999999997305939998083798650176179999 Q gi|255764514|r 428 ASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSKKIQLLAVTHAPQVAARADRHFLVYK 504 (554) Q Consensus 428 aSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~~~Qvi~ITH~pqvAa~a~~h~~v~K 504 (554) +|||++-|++||=.++ .++|.+||||.-++++..+...+-+.|+++.++.=+|+|||-+.....+|+=++..+ T Consensus 139 LSgGQ~QRi~lARal~----~~~~iliLDEpts~LD~~~e~~i~~~l~~~~~~~TvI~itH~l~~l~~~D~Iivl~~ 211 (234) T cd03251 139 LSGGQRQRIAIARALL----KDPPILILDEATSALDTESERLVQAALERLMKNRTTFVIAHRLSTIENADRIVVLED 211 (234) T ss_pred CCHHHHHHHHHHHHHH----CCCCEEEEECCCCCCCHHHHHHHHHHHHHHHCCCEEEEEECCHHHHHHCCEEEEEEC T ss_conf 8999999999999996----499989996876689989999999999998199989999278889985999999989 No 59 >cd03253 ABCC_ATM1_transporter ATM1 is an ABC transporter that is expressed in the mitochondria. Although the specific function of ATM1 is unknown, its disruption results in the accumulation of excess mitochondrial iron, loss of mitochondrial cytochromes, oxidative damage to mitochondrial DNA, and decreased levels of cytosolic heme proteins. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins. Probab=98.63 E-value=3.7e-07 Score=66.17 Aligned_cols=73 Identities=26% Similarity=0.376 Sum_probs=64.9 Q ss_pred HCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCEEEEECHHHHHHHCCCEEEEEE Q ss_conf 06215799999999984366899769980344688879999999999997305939998083798650176179999 Q gi|255764514|r 428 ASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSKKIQLLAVTHAPQVAARADRHFLVYK 504 (554) Q Consensus 428 aSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~~~Qvi~ITH~pqvAa~a~~h~~v~K 504 (554) +|||++-|++||=.++ .++|.+||||.-++++-.+-..+=+.|+++.++.=+|+|||.+..+..+|+=++..+ T Consensus 138 LSgGQ~QrialARal~----~~~~ililDEpts~LD~~te~~i~~~l~~~~~~~Tvi~itHr~~~~~~~D~Iivl~~ 210 (236) T cd03253 138 LSGGEKQRVAIARAIL----KNPPILLLDEATSALDTHTEREIQAALRDVSKGRTTIVIAHRLSTIVNADKIIVLKD 210 (236) T ss_pred CCHHHHHHHHHHHHHH----CCCCEEEEECCCCCCCHHHHHHHHHHHHHHHCCCEEEEECCCHHHHHHCCEEEEEEC T ss_conf 6999999999999996----499999996875679989999999999998099989998268788985999999989 No 60 >PRK11176 lipid transporter ATP-binding/permease protein; Provisional Probab=98.61 E-value=4.1e-07 Score=65.86 Aligned_cols=74 Identities=28% Similarity=0.410 Sum_probs=66.1 Q ss_pred HHCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCEEEEECHHHHHHHCCCEEEEEE Q ss_conf 406215799999999984366899769980344688879999999999997305939998083798650176179999 Q gi|255764514|r 427 LASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSKKIQLLAVTHAPQVAARADRHFLVYK 504 (554) Q Consensus 427 iaSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~~~Qvi~ITH~pqvAa~a~~h~~v~K 504 (554) -+||||+=|++||=.+. .++|.+||||.-++++-+|...|-+.|+++.+++=+|+|||-+.....||.=++..+ T Consensus 479 ~LSgGQrQRialARall----~~~~iliLDE~TSalD~~te~~i~~~l~~~~~~~Tvi~IaHrl~~i~~~D~I~vl~~ 552 (581) T PRK11176 479 LLSGGQRQRIAIARALL----RDSPILILDEATSALDTESERAIQAALDELQKNRTSLVIAHRLSTIEKADEILVVED 552 (581) T ss_pred CCCHHHHHHHHHHHHHH----CCCCEEEEECCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCHHHHHHCCEEEEEEC T ss_conf 78999999999999996----799989985863358999999999999997399999997188989984998999989 No 61 >COG4988 CydD ABC-type transport system involved in cytochrome bd biosynthesis, ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Probab=98.61 E-value=3.3e-07 Score=66.44 Aligned_cols=74 Identities=28% Similarity=0.372 Sum_probs=65.5 Q ss_pred HHCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCEEEEECHHHHHHHCCCEEEEEE Q ss_conf 406215799999999984366899769980344688879999999999997305939998083798650176179999 Q gi|255764514|r 427 LASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSKKIQLLAVTHAPQVAARADRHFLVYK 504 (554) Q Consensus 427 iaSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~~~Qvi~ITH~pqvAa~a~~h~~v~K 504 (554) -+|||+.=|++||=.+. .|.|.++|||.-|+++-++...|-+-|-++++..=||+|||.++.++.+|.=+++.. T Consensus 456 ~LSgGQ~QRlaLARAll----~~~~l~llDEpTA~LD~etE~~i~~~l~~l~~~ktvl~itHrl~~~~~~D~I~vld~ 529 (559) T COG4988 456 GLSGGQAQRLALARALL----SPASLLLLDEPTAHLDAETEQIILQALQELAKQKTVLVITHRLEDAADADRIVVLDN 529 (559) T ss_pred CCCHHHHHHHHHHHHHC----CCCCEEEECCCCCCCCHHHHHHHHHHHHHHHHCCEEEEEECCHHHHHCCCEEEEECC T ss_conf 77899999999999855----888889854875679876799999999999727869999767377854998999648 No 62 >PRK13657 cyclic beta-1,2-glucan ABC transporter; Provisional Probab=98.61 E-value=4.9e-07 Score=65.36 Aligned_cols=73 Identities=23% Similarity=0.362 Sum_probs=65.5 Q ss_pred HCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCEEEEECHHHHHHHCCCEEEEEE Q ss_conf 06215799999999984366899769980344688879999999999997305939998083798650176179999 Q gi|255764514|r 428 ASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSKKIQLLAVTHAPQVAARADRHFLVYK 504 (554) Q Consensus 428 aSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~~~Qvi~ITH~pqvAa~a~~h~~v~K 504 (554) +|||++=|++||=.+. .++|.+||||.-++++-.|-..|-+.|+++.+++=+|+|||-|-....||+=+++.+ T Consensus 472 LSGGQrQRialARAll----~~p~IliLDEaTSaLD~~tE~~i~~~l~~~~~~~T~iiIaHRlsti~~aD~Iivl~~ 544 (585) T PRK13657 472 LSGGERQRLAIARALL----KDPPILILDEATSALDAETEAKVKAALDEVMKGRTTFIIAHRLSTVRNADRILVFDN 544 (585) T ss_pred CCHHHHHHHHHHHHHH----CCCCEEEEECCCCCCCHHHHHHHHHHHHHHHCCCEEEEEECCHHHHHHCCEEEEEEC T ss_conf 8999999999999994----698989986887689999999999999998489989996068888996999999989 No 63 >cd03249 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) is a mitochondrial ATP-binding cassette protein involved in iron homeostasis and one of four ABC transporters expressed in the mitochondrial inner membrane, the other three being MDL1(ABC7), MDL2, and ATM1. In fact, the yeast MDL1 (multidrug resistance-like protein 1) and MDL2 (multidrug resistance-like protein 2) transporters are also included in this CD. MDL1 is an ATP-dependent permease that acts as a high-copy suppressor of ATM1 and is thought to have a role in resistance to oxidative stress. Interestingly, subfamily B is more closely related to the carboxyl-terminal component of subfamily C than the two halves of ABCC molecules are with one another. Probab=98.60 E-value=4.7e-07 Score=65.44 Aligned_cols=73 Identities=19% Similarity=0.252 Sum_probs=64.6 Q ss_pred HCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCEEEEECHHHHHHHCCCEEEEEE Q ss_conf 06215799999999984366899769980344688879999999999997305939998083798650176179999 Q gi|255764514|r 428 ASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSKKIQLLAVTHAPQVAARADRHFLVYK 504 (554) Q Consensus 428 aSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~~~Qvi~ITH~pqvAa~a~~h~~v~K 504 (554) +|||++-|++||=.++ .++|.+||||.-++++-.+...+-+.|+++.++.=+|+|||-+.....+|+=++..+ T Consensus 140 LSgGQ~QRialARAl~----~~~~ililDE~tsaLD~~te~~i~~~l~~~~~~~TvI~ItHrl~~l~~~D~Iivl~~ 212 (238) T cd03249 140 LSGGQKQRIAIARALL----RNPKILLLDEATSALDAESEKLVQEALDRAMKGRTTIVIAHRLSTIRNADLIAVLQN 212 (238) T ss_pred CCHHHHHHHHHHHHHH----CCCCEEEEECCCCCCCHHHHHHHHHHHHHHHCCCEEEEECCCHHHHHHCCEEEEEEC T ss_conf 8999999999999996----599999997876678999999999999998099989998488889985999999989 No 64 >PRK10584 putative ABC transporter ATP-binding protein YbbA; Provisional Probab=98.59 E-value=4.5e-07 Score=65.58 Aligned_cols=72 Identities=35% Similarity=0.417 Sum_probs=63.6 Q ss_pred HCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHC--CCEEEEECHHHHHHHCCCEEEEE Q ss_conf 06215799999999984366899769980344688879999999999997305--93999808379865017617999 Q gi|255764514|r 428 ASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSKK--IQLLAVTHAPQVAARADRHFLVY 503 (554) Q Consensus 428 aSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~~--~Qvi~ITH~pqvAa~a~~h~~v~ 503 (554) +||||+=|+++|-.++ ..++.+++||.=+|++-.+...|-+.|+++.+. .=||+|||-|.+|+.+|+-+.+. T Consensus 147 LSGGq~QRv~iAraL~----~~P~llllDEPT~~LD~~~~~~i~~~l~~l~~~~g~tii~vtHd~~~~~~~drvi~l~ 220 (228) T PRK10584 147 LSGGEQQRVALARAFN----GRPDVLFADEPTGNLDRQTGDKIADLLFSLNREHGTTLILVTHDLQLAARCDRRLRLV 220 (228) T ss_pred CCHHHHHHHHHHHHHH----CCCCEEEECCCCCCCCHHHHHHHHHHHHHHHHHCCCEEEEECCCHHHHHHCCCEEEEE T ss_conf 9979999999999987----5999999849976789999999999999999972989999886699998589799998 No 65 >cd03248 ABCC_TAP TAP, the Transporter Associated with Antigen Processing; TAP is essential for peptide delivery from the cytosol into the lumen of the endoplasmic reticulum (ER), where these peptides are loaded on major histocompatibility complex (MHC) I molecules. Loaded MHC I leave the ER and display their antigenic cargo on the cell surface to cytotoxic T cells. Subsequently, virus-infected or malignantly transformed cells can be eliminated. TAP belongs to the large family of ATP-binding cassette (ABC) transporters, which translocate a vast variety of solutes across membranes. Probab=98.58 E-value=4.3e-07 Score=65.68 Aligned_cols=72 Identities=21% Similarity=0.359 Sum_probs=63.9 Q ss_pred HCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCEEEEECHHHHHHHCCCEEEEE Q ss_conf 0621579999999998436689976998034468887999999999999730593999808379865017617999 Q gi|255764514|r 428 ASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSKKIQLLAVTHAPQVAARADRHFLVY 503 (554) Q Consensus 428 aSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~~~Qvi~ITH~pqvAa~a~~h~~v~ 503 (554) +|||++-|++||=.++ .++|.+||||.=++++-.+...|-+.|+++.++.=+|+|||-+..+.++|+=++.. T Consensus 151 LSgGqkQRialARal~----~~p~ililDEptSaLD~~te~~i~~~l~~~~~~~Tvi~ItH~l~~~~~~DrIivme 222 (226) T cd03248 151 LSGGQKQRVAIARALI----RNPQVLILDEATSALDAESEQQVQQALYDWPERRTVLVIAHRLSTVERADQILVLD 222 (226) T ss_pred CCHHHHHHHHHHHHHH----CCCCEEEEECCCCCCCHHHHHHHHHHHHHHCCCCEEEEEECCHHHHHHCCEEEEEE T ss_conf 6999999999999997----59999999797668899999999999998669999999937999998499999993 No 66 >PRK11160 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Probab=98.56 E-value=7.2e-07 Score=64.23 Aligned_cols=80 Identities=25% Similarity=0.312 Sum_probs=68.8 Q ss_pred CCCCCCHHHHHHCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCEEEEECHHHHHHHC Q ss_conf 89983113544062157999999999843668997699803446888799999999999973059399980837986501 Q gi|255764514|r 417 RGENPGPLMKLASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSKKIQLLAVTHAPQVAARA 496 (554) Q Consensus 417 ~g~~~~pl~kiaSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~~~Qvi~ITH~pqvAa~a 496 (554) -|+.-..| ||||+=|+++|=.++ .++|.+||||-=++++.+|...|=+.|+++.+++=+|+|||-+.....| T Consensus 470 vGe~G~~L----SGGQrQRiaiARAll----~~~~iliLDEaTs~LD~~te~~i~~~l~~~~~~rT~i~IaHRlsti~~a 541 (575) T PRK11160 470 LGEGGRQL----SGGEQRRLGIARALL----HDAPLLLLDEPTEGLDAETERQILELLFEHAQNKTVLMITHRLTGLEQF 541 (575) T ss_pred CCCCCCCC----CHHHHHHHHHHHHHH----CCCCEEEEECCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCHHHHHHC T ss_conf 37889959----999999999999994----5999999849866679999999999999866999999971669899959 Q ss_pred CCEEEEEE Q ss_conf 76179999 Q gi|255764514|r 497 DRHFLVYK 504 (554) Q Consensus 497 ~~h~~v~K 504 (554) |+=++..+ T Consensus 542 D~I~vl~~ 549 (575) T PRK11160 542 DQICVMDN 549 (575) T ss_pred CEEEEEEC T ss_conf 99999989 No 67 >cd03252 ABCC_Hemolysin The ABC-transporter hemolysin B is a central component of the secretion machinery that translocates the toxin, hemolysin A, in a Sec-independent fashion across both membranes of E. coli. The hemolysin A (HlyA) transport machinery is composed of the ATP-binding cassette (ABC) transporter HlyB located in the inner membrane, hemolysin D (HlyD), also anchored in the inner membrane, and TolC, which resides in the outer membrane. HlyD apparently forms a continuous channel that bridges the entire periplasm, interacting with TolC and HlyB. This arrangement prevents the appearance of periplasmic intermediates of HlyA during substrate transport. Little is known about the molecular details of HlyA transport, but it is evident that ATP-hydrolysis by the ABC-transporter HlyB is a necessary source of energy. Probab=98.56 E-value=6.8e-07 Score=64.41 Aligned_cols=72 Identities=22% Similarity=0.337 Sum_probs=63.0 Q ss_pred HCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCEEEEECHHHHHHHCCCEEEEE Q ss_conf 0621579999999998436689976998034468887999999999999730593999808379865017617999 Q gi|255764514|r 428 ASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSKKIQLLAVTHAPQVAARADRHFLVY 503 (554) Q Consensus 428 aSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~~~Qvi~ITH~pqvAa~a~~h~~v~ 503 (554) +|||++-|++||=.++ .++|.+||||.=++++..+-..+-+.|+++.++.=+|+|||-+..+..+|+=++.. T Consensus 139 LSgGqkQRlalARall----~~~~illlDEpts~LD~~te~~i~~~l~~~~~~~Tvi~itHrl~~l~~aD~Iivl~ 210 (237) T cd03252 139 LSGGQRQRIAIARALI----HNPRILIFDEATSALDYESEHAIMRNMHDICAGRTVIIIAHRLSTVKNADRIIVME 210 (237) T ss_pred CCHHHHHHHHHHHHHH----CCCCEEEEECCCCCCCHHHHHHHHHHHHHHHCCCEEEEEECCHHHHHHCCEEEEEE T ss_conf 8999999999999996----69999999486456898999999999999829999999807888998499999998 No 68 >cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain. They export degradative enzymes by using a type I protein secretion system and lack an N-terminal signal peptide, but contain a C-terminal secretion signal. The Type I secretion apparatus is made up of three components, an ABC transporter, a membrane fusion protein (MFP), and an outer membrane protein (OMP). For the HlyA transporter complex, HlyB (ABC transporter) and HlyD (MFP) reside in the inner membrane of E. coli. The OMP component is TolC, which is thought to interact with the MFP to form a continuous channel across the periplasm from the cytoplasm to the exterior. HlyB belongs to the family of ABC transporters, which are ubiquitous, ATP-dependent transmembrane pumps or channels. The spectrum of transport substra Probab=98.55 E-value=5.5e-07 Score=65.00 Aligned_cols=72 Identities=28% Similarity=0.371 Sum_probs=61.3 Q ss_pred HCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHH-HCCCEEEEECHHHHHHHCCCEEEEE Q ss_conf 062157999999999843668997699803446888799999999999973-0593999808379865017617999 Q gi|255764514|r 428 ASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLS-KKIQLLAVTHAPQVAARADRHFLVY 503 (554) Q Consensus 428 aSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls-~~~Qvi~ITH~pqvAa~a~~h~~v~ 503 (554) +||||+-|++||=.++ ..+|.+||||.-++++-.+...|-+.|+++. +..=+|.|||.|..+..||+=++.. T Consensus 97 LSGGQkQRvalARal~----~~p~ililDEpts~LD~~~e~~i~~~l~~l~~~~~Tvi~vtH~~~~~~~aD~Iivl~ 169 (173) T cd03246 97 LSGGQRQRLGLARALY----GNPRILVLDEPNSHLDVEGERALNQAIAALKAAGATRIVIAHRPETLASADRILVLE 169 (173) T ss_pred CCHHHHHHHHHHHHHH----CCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCEEEEECCCHHHHHHCCEEEEEE T ss_conf 7699999999999982----799999996876689989999999999978648989999847999998499999993 No 69 >PRK10247 putative ABC transporter ATP-binding protein YbbL; Provisional Probab=98.53 E-value=7.8e-07 Score=64.02 Aligned_cols=73 Identities=22% Similarity=0.267 Sum_probs=62.3 Q ss_pred HCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCC--CEEEEECHHHHHHHCCCEEEEEE Q ss_conf 062157999999999843668997699803446888799999999999973059--39998083798650176179999 Q gi|255764514|r 428 ASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSKKI--QLLAVTHAPQVAARADRHFLVYK 504 (554) Q Consensus 428 aSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~~~--Qvi~ITH~pqvAa~a~~h~~v~K 504 (554) +||||+-|++||-.++ ..++.++|||.-+|++-.+...|-+.|+++.+.. =||+|||-+..+.+||+-++... T Consensus 138 LSGGqkQRv~iARaL~----~~p~iLllDEPts~LD~~~~~~i~~~i~~l~~~~~~tvi~vtHd~~~~~~aDrIivL~~ 212 (225) T PRK10247 138 LSGGEKQRISLIRNLQ----FMPKVLLLDEITSALDESNKHNVNEIIHRYVREQNIAVLWVTHDKDEINHADKVITLQP 212 (225) T ss_pred CCHHHHHHHHHHHHHH----CCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHCCCEEEEEECCHHHHHCCCEEEEEEC T ss_conf 8999999999999986----09999999597666899999999999999998389899999039999970998999968 No 70 >PRK11174 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Probab=98.53 E-value=9.4e-07 Score=63.47 Aligned_cols=74 Identities=22% Similarity=0.228 Sum_probs=65.6 Q ss_pred HHCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCEEEEECHHHHHHHCCCEEEEEE Q ss_conf 406215799999999984366899769980344688879999999999997305939998083798650176179999 Q gi|255764514|r 427 LASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSKKIQLLAVTHAPQVAARADRHFLVYK 504 (554) Q Consensus 427 iaSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~~~Qvi~ITH~pqvAa~a~~h~~v~K 504 (554) -+||||+=|+++|=.+. .++|.+||||.=++++-.|-..|=+.|+++.++.=+|+|||-+.....||+=++..+ T Consensus 485 ~LSGGQrQRiaiARAll----~~~~ILILDEaTSaLD~~tE~~i~~~L~~~~~~rTviiIaHRlsti~~aD~Iivld~ 558 (588) T PRK11174 485 GLSVGQAQRLALARALL----QPCQLLLLDEPTASLDAHSEQLVMQALNAASQGQTTLMVTHQLEDLAQMDQILVMQD 558 (588) T ss_pred CCCHHHHHHHHHHHHHH----CCCCEEEEECCCCCCCHHHHHHHHHHHHHHCCCCEEEEEECCHHHHHHCCEEEEEEC T ss_conf 77999999999999983----798989998987798999999999999986799989998067999984999999989 No 71 >cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis. The CydC and CydD proteins are important for the formation of cytochrome bd terminal oxidase of E. coli and it has been proposed that they were necessary for biosynthesis of the cytochrome bd quinol oxidase and for periplasmic c-type cytochromes. CydCD were proposed to determine a heterooligomeric complex important for heme export into the periplasm or to be involved in the maintenance of the proper redox state of the periplasmic space. In Bacillus subtilius, the absence of CydCD does not affect the presence of halo-cytochrome c in the membrane and this observation suggests that CydCD proteins are not involved in the export of heme in this organism. Probab=98.53 E-value=6.3e-07 Score=64.60 Aligned_cols=72 Identities=22% Similarity=0.293 Sum_probs=62.9 Q ss_pred HCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCEEEEECHHHHHHHCCCEEEEE Q ss_conf 0621579999999998436689976998034468887999999999999730593999808379865017617999 Q gi|255764514|r 428 ASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSKKIQLLAVTHAPQVAARADRHFLVY 503 (554) Q Consensus 428 aSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~~~Qvi~ITH~pqvAa~a~~h~~v~ 503 (554) +|||++-|+++|=.++ .++|.+||||.-+|++-.+...+-+.|+++.+..=||.|||-.+....+|+=+++. T Consensus 99 LSgGqkqRv~iAral~----~~p~ililDEpts~LD~~t~~~i~~~l~~~~~~~Tvi~itH~~~~l~~~D~Iivl~ 170 (178) T cd03247 99 FSGGERQRLALARILL----QDAPIVLLDEPTVGLDPITERQLLSLIFEVLKDKTLIWITHHLTGIEHMDKILFLE 170 (178) T ss_pred CCHHHHHHHHHHHHHH----HCCCEEEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEEECCHHHHHHCCEEEEEE T ss_conf 8999999999999996----49797672286556998999999999999839999999805898998699999998 No 72 >cd03369 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-type transporter 1). NFT1 belongs to the MRP (mulrtidrug resisitance-associated protein) family of ABC transporters. Some of the MRP members have five additional transmembrane segments in their N-terminas, but the function of these additional membrane-spanning domains is not clear. The MRP was found in the multidrug-resisting lung cancer cell in which p-glycoprotein was not overexpressed. MRP exports glutathione by drug stimulation, as well as, certain substrates in conjugated forms with anions such as glutathione, glucuronate, and sulfate. Probab=98.52 E-value=7.4e-07 Score=64.13 Aligned_cols=72 Identities=19% Similarity=0.229 Sum_probs=62.2 Q ss_pred HCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCEEEEECHHHHHHHCCCEEEEE Q ss_conf 0621579999999998436689976998034468887999999999999730593999808379865017617999 Q gi|255764514|r 428 ASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSKKIQLLAVTHAPQVAARADRHFLVY 503 (554) Q Consensus 428 aSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~~~Qvi~ITH~pqvAa~a~~h~~v~ 503 (554) +|||++-|++||-.++ ...+.+||||.-++++-.+...|-+.++++.++.=||+|||-+..+..+|+=++.. T Consensus 126 LSgGqkQrl~iARal~----~~p~ililDEpts~LD~~~~~~i~~~i~~~~~~~Tvi~itH~l~~~~~~D~Iivl~ 197 (207) T cd03369 126 LSQGQRQLLCLARALL----KRPRVLVLDEATASIDYATDALIQKTIREEFTNSTILTIAHRLRTIIDYDKILVMD 197 (207) T ss_pred CCHHHHHHHHHHHHHH----CCCCEEEEECCCCCCCHHHHHHHHHHHHHHCCCCEEEEEECCHHHHHHCCEEEEEE T ss_conf 6989999999999997----08999998163444898999999999999759999999907999998599999998 No 73 >PRK10790 putative multidrug transporter membrane\ATP-binding components; Provisional Probab=98.52 E-value=9.8e-07 Score=63.34 Aligned_cols=73 Identities=22% Similarity=0.309 Sum_probs=65.8 Q ss_pred HCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCEEEEECHHHHHHHCCCEEEEEE Q ss_conf 06215799999999984366899769980344688879999999999997305939998083798650176179999 Q gi|255764514|r 428 ASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSKKIQLLAVTHAPQVAARADRHFLVYK 504 (554) Q Consensus 428 aSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~~~Qvi~ITH~pqvAa~a~~h~~v~K 504 (554) +||||+-|++||=.++ .++|.+||||.-++++-.+-..|-+.|+++.+++=+|+|||-+.....||+=++..+ T Consensus 477 LSgGQrQRiaiARall----~~p~iliLDEaTSaLD~~tE~~i~~~l~~~~~~~T~i~IaHRlsti~~aD~I~vl~~ 549 (593) T PRK10790 477 LSVGQKQLLALARVLV----ETPQILILDEATASIDSGTEQAIQQALAAIREHTTLVVIAHRLSTIVEADTILVLHR 549 (593) T ss_pred CCHHHHHHHHHHHHHH----CCCCEEEEECCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCHHHHHHCCEEEEEEC T ss_conf 7999999999999995----598999983877788999999999999997289989997078989996999999989 No 74 >cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE). They are clustered together phylogenetically. MacAB is an exporter that confers resistance to macrolides, while the LolCDE system is not a transporter at all. An FtsE null mutants showed filamentous growth and appeared viable on high salt medium only, indicating a role for FtsE in cell division and/or salt transport. The LolCDE complex catalyses the release of lipoproteins from the cytoplasmic membrane prior to their targeting to the outer membrane. Probab=98.50 E-value=9.1e-07 Score=63.55 Aligned_cols=73 Identities=25% Similarity=0.379 Sum_probs=63.4 Q ss_pred HCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHC--CCEEEEECHHHHHHHCCCEEEEEE Q ss_conf 06215799999999984366899769980344688879999999999997305--939998083798650176179999 Q gi|255764514|r 428 ASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSKK--IQLLAVTHAPQVAARADRHFLVYK 504 (554) Q Consensus 428 aSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~~--~Qvi~ITH~pqvAa~a~~h~~v~K 504 (554) +||||+=|+++|-.++ ..++.++|||.=+|++-.+...|-+.|+++++. .=||.|||-+-+|.+||+=+...+ T Consensus 141 LSGG~kQRv~iAraL~----~~P~llllDEPTs~LD~~~~~~i~~~l~~l~~~~~~tii~itHd~~~~~~aDrv~~m~~ 215 (218) T cd03255 141 LSGGQQQRVAIARALA----NDPKIILADEPTGNLDSETGKEVMELLRELNKEAGTTIVVVTHDPELAEYADRIIELRD 215 (218) T ss_pred CCHHHHHHHHHHHHHH----CCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHCCCEEEEECCCHHHHHHCCEEEEEEC T ss_conf 8999999999999985----59999998188876899999999999999999629899998968899986998999989 No 75 >COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Probab=98.49 E-value=1.1e-06 Score=63.05 Aligned_cols=73 Identities=26% Similarity=0.389 Sum_probs=63.1 Q ss_pred HCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHC--CCEEEEECHHHHHHHCCCEEEEEE Q ss_conf 06215799999999984366899769980344688879999999999997305--939998083798650176179999 Q gi|255764514|r 428 ASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSKK--IQLLAVTHAPQVAARADRHFLVYK 504 (554) Q Consensus 428 aSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~~--~Qvi~ITH~pqvAa~a~~h~~v~K 504 (554) +||||.=|++.|=.++ .+++.++-||.-.+++-+++..|=++|+++.+. .=||+|||-|.+|.++|+.+.+.. T Consensus 143 LSGGqqQRVAIARAL~----~~P~iilADEPTgnLD~~t~~~V~~ll~~~~~~~g~tii~VTHD~~lA~~~dr~i~l~d 217 (226) T COG1136 143 LSGGQQQRVAIARALI----NNPKIILADEPTGNLDSKTAKEVLELLRELNKERGKTIIMVTHDPELAKYADRVIELKD 217 (226) T ss_pred CCHHHHHHHHHHHHHH----CCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHCCCEEEEECCCHHHHHHCCEEEEEEC T ss_conf 6979999999999982----49986996076665886789999999999987469899999089899974898999848 No 76 >TIGR03608 L_ocin_972_ABC putative bacteriocin export ABC transporter, lactococcin 972 group. A gene pair with a fairly wide distribution consists of a polypeptide related to the lactococcin 972 (see TIGR01653) and multiple-membrane-spanning putative immunity protein (see TIGR01654). This model represents a small clade within the ABC transporters that regularly are found adjacent to these bacteriocin system gene pairs and are likely serve as export proteins. Probab=98.48 E-value=1.1e-06 Score=63.06 Aligned_cols=69 Identities=32% Similarity=0.404 Sum_probs=59.2 Q ss_pred HCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHC-CCEEEEECHHHHHHHCCCEE Q ss_conf 06215799999999984366899769980344688879999999999997305-93999808379865017617 Q gi|255764514|r 428 ASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSKK-IQLLAVTHAPQVAARADRHF 500 (554) Q Consensus 428 aSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~~-~Qvi~ITH~pqvAa~a~~h~ 500 (554) +||||+-|+++|=.++ ..++.+++||.=++++-.++..|-++|+++.+. .=+|+|||-|.+|+++|+=+ T Consensus 135 LSGGe~QRVAIARAL~----~~P~illaDEPT~~LD~~~~~~i~~ll~~l~~~g~tii~vTHd~~~a~~~Drvi 204 (206) T TIGR03608 135 LSGGEQQRVALARAIL----KPSELILADEPTGSLDPKNRDEVLDLLLELNDEGKTIIIVTHDPEVAEQADRVI 204 (206) T ss_pred CCHHHHHHHHHHHHHH----CCCCEEEECCCCCCCCHHHHHHHHHHHHHHHHCCCEEEEECCCHHHHHHCCEEE T ss_conf 4869999999999982----499999963998778999999999999999867999999898789998699899 No 77 >cd03271 ABC_UvrA_II The excision repair protein UvrA domain II; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion. Recognition and cleavage of the damaged DNA is a multistep ATP-dependent reaction that requires the UvrA, UvrB, and UvrC proteins. Both UvrA and UvrB are ATPases, with UvrA having two ATP binding sites, which have the characteristic signature of the family of ABC proteins and UvrB having one ATP binding site that is structurally related to that of helicases. Probab=98.46 E-value=1.4e-06 Score=62.28 Aligned_cols=74 Identities=22% Similarity=0.215 Sum_probs=60.5 Q ss_pred HCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHH-CCCEEEEECHHHHHHHCCCEEEE Q ss_conf 0621579999999998436689976998034468887999999999999730-59399980837986501761799 Q gi|255764514|r 428 ASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSK-KIQLLAVTHAPQVAARADRHFLV 502 (554) Q Consensus 428 aSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~-~~Qvi~ITH~pqvAa~a~~h~~v 502 (554) +||||+=|++||-.++- +....+.+||||.-+|++-.+...+-+.|+++.+ .+-||+|||-..++..||+-++. T Consensus 170 LSGGqkQRvaiAraL~~-~~~~P~lllLDEPTs~LD~~~~~~l~~~l~~l~~~G~Tvi~itH~l~~~~~aD~IivL 244 (261) T cd03271 170 LSGGEAQRIKLAKELSK-RSTGKTLYILDEPTTGLHFHDVKKLLEVLQRLVDKGNTVVVIEHNLDVIKCADWIIDL 244 (261) T ss_pred CCHHHHHHHHHHHHHHH-CCCCCCEEEECCCCCCCCHHHHHHHHHHHHHHHHCCCEEEEEEECHHHHHHCCEEEEC T ss_conf 68899999999999972-5888967995486345998999999999999997899999984778899738999993 No 78 >PRK11629 lolD lipoprotein transporter ATP-binding subunit; Provisional Probab=98.46 E-value=1.5e-06 Score=62.08 Aligned_cols=71 Identities=31% Similarity=0.379 Sum_probs=61.6 Q ss_pred HCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHH--CCCEEEEECHHHHHHHCCCEEEE Q ss_conf 0621579999999998436689976998034468887999999999999730--59399980837986501761799 Q gi|255764514|r 428 ASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSK--KIQLLAVTHAPQVAARADRHFLV 502 (554) Q Consensus 428 aSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~--~~Qvi~ITH~pqvAa~a~~h~~v 502 (554) +||||+=|+++|-.++ ..++.+++||.=+|++..+...|-++|+++.+ ..=||+|||-+.+|.+++.++.. T Consensus 146 LSGGqkQRvaiAraL~----~~P~illlDEPTs~LD~~~~~~i~~~l~~l~~~~g~tvi~vtHdl~~a~~~~r~i~m 218 (233) T PRK11629 146 LSGGERQRVAIARALV----NNPRLVLADEPTGNLDARNADSIFQLLGELNRLQGTAFLVVTHDLQLAKRMSRQLEM 218 (233) T ss_pred ECHHHHHHHHHHHHHH----CCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHCCCEEEEECCCHHHHHHHCCEEEE T ss_conf 3899999999999996----599999992888879999999999999999997098999986899999960989999 No 79 >PRK13547 hmuV hemin importer ATP-binding subunit; Provisional Probab=98.45 E-value=2.2e-06 Score=61.08 Aligned_cols=75 Identities=29% Similarity=0.403 Sum_probs=60.6 Q ss_pred HCCHHHHHHHHHHHHHH------CCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCC--EEEEECHHHHHHH-CCC Q ss_conf 06215799999999984------36689976998034468887999999999999730593--9998083798650-176 Q gi|255764514|r 428 ASGGELSRFLLALKIVL------VDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSKKIQ--LLAVTHAPQVAAR-ADR 498 (554) Q Consensus 428 aSGGE~Sr~~LAl~~~~------~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~~~Q--vi~ITH~pqvAa~-a~~ 498 (554) +||||+-|+++|-.++. +....+..+++||.-+|++-.+...+-+.|+++.+... ||+|||-+..|+. ||+ T Consensus 146 LSGGq~qRv~iAraL~~l~~~~~al~~~P~lLlLDEPts~LD~~~~~~i~~~l~~l~~e~g~tvl~vtHdl~~~~~~aDr 225 (273) T PRK13547 146 LSGGELARVQFARVLAQLWPPDPGAAQPPRYLLLDEPTAALDLAHQHRLLDTVRRLAREWNLGVLAIVHDPNLAARHADR 225 (273) T ss_pred CCHHHHHHHHHHHHHHHHCCCCCCCCCCCCEEEECCCCCCCCHHHHHHHHHHHHHHHHHCCCEEEEEECCHHHHHHHCCE T ss_conf 69999999999999985101110136898689972874448999999999999999983798999998899999997999 Q ss_pred EEEE Q ss_conf 1799 Q gi|255764514|r 499 HFLV 502 (554) Q Consensus 499 h~~v 502 (554) =++. T Consensus 226 i~vL 229 (273) T PRK13547 226 IAML 229 (273) T ss_pred EEEE T ss_conf 9999 No 80 >cd03244 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C. This family is also known as MRP (mulrtidrug resisitance-associated protein). Some of the MRP members have five additional transmembrane segments in their N-terminus, but the function of these additional membrane-spanning domains is not clear. The MRP was found in the multidrug-resistance lung cancer cell in which p-glycoprotein was not overexpressed. MRP exports glutathione by drug stimulation, as well as, certain substrates in conjugated forms with anions, such as glutathione, glucuronate, and sulfate. Probab=98.45 E-value=1.6e-06 Score=62.03 Aligned_cols=72 Identities=19% Similarity=0.260 Sum_probs=61.7 Q ss_pred HCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCEEEEECHHHHHHHCCCEEEEE Q ss_conf 0621579999999998436689976998034468887999999999999730593999808379865017617999 Q gi|255764514|r 428 ASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSKKIQLLAVTHAPQVAARADRHFLVY 503 (554) Q Consensus 428 aSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~~~Qvi~ITH~pqvAa~a~~h~~v~ 503 (554) +|||++-|++||-.++ ..++.+||||.-+|++-.+...+-+.|++..++.=||+|||-+..+..+|+=++.. T Consensus 140 LSgGqkQrv~lARal~----~~p~ililDEpts~LD~~~~~~i~~~l~~~~~~~Tvi~itH~l~~~~~~Dri~vl~ 211 (221) T cd03244 140 LSVGQRQLLCLARALL----RKSKILVLDEATASVDPETDALIQKTIREAFKDCTVLTIAHRLDTIIDSDRILVLD 211 (221) T ss_pred CCHHHHHHHHHHHHHH----CCCCEEEEECCCCCCCHHHHHHHHHHHHHHCCCCEEEEEECCHHHHHHCCEEEEEE T ss_conf 9999999999999996----59999999797567999999999999998779989999915889998399899998 No 81 >PRK13640 cbiO cobalt transporter ATP-binding subunit; Provisional Probab=98.44 E-value=1.4e-06 Score=62.34 Aligned_cols=73 Identities=25% Similarity=0.315 Sum_probs=62.2 Q ss_pred HCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHC--CCEEEEECHHHHHHHCCCEEEEEE Q ss_conf 06215799999999984366899769980344688879999999999997305--939998083798650176179999 Q gi|255764514|r 428 ASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSKK--IQLLAVTHAPQVAARADRHFLVYK 504 (554) Q Consensus 428 aSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~~--~Qvi~ITH~pqvAa~a~~h~~v~K 504 (554) +|||++=|+++|-.++ ..++.+||||.=+|++-.+...|-+.|+++.+. .-||+|||-...|.+||+=++..+ T Consensus 145 LSGGqkQRvaiA~aLa----~~P~iLllDEPTs~LD~~~~~~i~~~l~~l~~e~g~TvI~itHd~~~a~~aDrv~vm~~ 219 (283) T PRK13640 145 LSGGQKQRVAIAGILA----VEPQIIILDESTSMLDPAGKEQILKLIRKLMKDNNLTIISITHDIDEAAGADQVLVLDD 219 (283) T ss_pred CCHHHHHHHHHHHHHH----CCCCEEEECCCCCCCCHHHHHHHHHHHHHHHHCCCCEEEEEEECHHHHHHCCEEEEEEC T ss_conf 9999999999999997----19999997687454898999999999999997069899999788789970998999999 No 82 >TIGR03375 type_I_sec_LssB type I secretion system ATPase, LssB family. Type I protein secretion is a system in some Gram-negative bacteria to export proteins (often proteases) across both inner and outer membranes to the extracellular medium. This is one of three proteins of the type I secretion apparatus. Targeted proteins are not cleaved at the N-terminus, but rather carry signals located toward the extreme C-terminus to direct type I secretion. This model is related to models TIGR01842 and TIGR01846, and to bacteriocin ABC transporters that cleave their substrates during export. Probab=98.42 E-value=2.8e-06 Score=60.36 Aligned_cols=74 Identities=26% Similarity=0.321 Sum_probs=65.4 Q ss_pred HHCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCEEEEECHHHHHHHCCCEEEEEE Q ss_conf 406215799999999984366899769980344688879999999999997305939998083798650176179999 Q gi|255764514|r 427 LASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSKKIQLLAVTHAPQVAARADRHFLVYK 504 (554) Q Consensus 427 iaSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~~~Qvi~ITH~pqvAa~a~~h~~v~K 504 (554) -+|||++=|++||=.++ .+++.+||||.-++++..+-..+-+.|+++..+.=+|+|||-|.+...||+=+++.+ T Consensus 601 ~LSgGqrQri~lARAl~----~~p~ililDE~ts~LD~~~e~~i~~~l~~~~~~~T~i~itHrls~i~~aD~i~vl~~ 674 (694) T TIGR03375 601 SLSGGQRQAVALARALL----RDPPILLLDEPTSAMDNRSEERFKDRLKRWLAGKTLVLVTHRTSLLDLVDRIIVMDN 674 (694) T ss_pred CCCHHHHHHHHHHHHHH----CCCCEEEEECCCCCCCHHHHHHHHHHHHHHCCCCEEEEEECCHHHHHHCCEEEEEEC T ss_conf 46899999999999995----799989997875688999999999999986699989998168999984999999989 No 83 >cd03233 ABC_PDR_domain1 The pleiotropic drug resistance (PDR) family of ATP-binding cassette (ABC) transporters. PDR is a well-described phenomenon occurring in fungi and shares several similarities with processes in bacteria and higher eukaryotes. This PDR subfamily represents domain I of its (ABC-IM)2 organization. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds including sugars, ions, peptides, and more complex organic molecules. The nucleotide-binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins. Probab=98.42 E-value=1.2e-06 Score=62.84 Aligned_cols=73 Identities=21% Similarity=0.322 Sum_probs=59.9 Q ss_pred HCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHH--CCCEEEEECHH--HHHHHCCCEEEEE Q ss_conf 0621579999999998436689976998034468887999999999999730--59399980837--9865017617999 Q gi|255764514|r 428 ASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSK--KIQLLAVTHAP--QVAARADRHFLVY 503 (554) Q Consensus 428 aSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~--~~Qvi~ITH~p--qvAa~a~~h~~v~ 503 (554) +||||+=|+++|..++ ..++.++|||.-+|++-.++..+-+.|+++++ ..-+|++||.| .+...+|+-+... T Consensus 119 LSgGqkqRv~iA~aL~----~~P~illlDEPt~gLD~~~~~~i~~~l~~l~~~~~~t~ii~~~~~~~~~~~~~Dri~vl~ 194 (202) T cd03233 119 ISGGERKRVSIAEALV----SRASVLCWDNSTRGLDSSTALEILKCIRTMADVLKTTTFVSLYQASDEIYDLFDKVLVLY 194 (202) T ss_pred CCHHHHHHHHHHHHHH----HCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHCCCEEEEEEECCHHHHHHHCCEEEEEE T ss_conf 8999999999999995----299889983876568999999999999999987799899999069899999699999995 Q ss_pred E Q ss_conf 9 Q gi|255764514|r 504 K 504 (554) Q Consensus 504 K 504 (554) + T Consensus 195 ~ 195 (202) T cd03233 195 E 195 (202) T ss_pred C T ss_conf 9 No 84 >cd03270 ABC_UvrA_I The excision repair protein UvrA domain I; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion. Recognition and cleavage of the damaged DNA is a multistep ATP-dependent reaction that requires the UvrA, UvrB, and UvrC proteins. Both UvrA and UvrB are ATPases, with UvrA having two ATP binding sites, which have the characteristic signature of the family of ABC proteins, and UvrB having one ATP binding site that is structurally related to that of helicases. Probab=98.42 E-value=1.8e-06 Score=61.60 Aligned_cols=73 Identities=30% Similarity=0.290 Sum_probs=59.5 Q ss_pred HCCHHHHHHHHHHHHHHCCCCCC-CEEEEECCCCCCCHHHHHHHHHHHHHHHH-CCCEEEEECHHHHHHHCCCEEEEE Q ss_conf 06215799999999984366899-76998034468887999999999999730-593999808379865017617999 Q gi|255764514|r 428 ASGGELSRFLLALKIVLVDQGSI-PTLVFDEVDSGIGGAVADAIGYRLKQLSK-KIQLLAVTHAPQVAARADRHFLVY 503 (554) Q Consensus 428 aSGGE~Sr~~LAl~~~~~~~~~~-p~~ifDEiDagi~G~~a~~v~~~l~~ls~-~~Qvi~ITH~pqvAa~a~~h~~v~ 503 (554) +||||+=|+++|-.++. +|. +.+||||.-+|++-.....+-+.|++|.+ ..=||+|||-|.++..||+=+... T Consensus 138 LSGGq~QRv~iAraL~~---~~~~~lliLDEPTsgLD~~~~~~i~~~i~~l~~~G~Tvi~VsHd~~~~~~aDriivm~ 212 (226) T cd03270 138 LSGGEAQRIRLATQIGS---GLTGVLYVLDEPSIGLHPRDNDRLIETLKRLRDLGNTVLVVEHDEDTIRAADHVIDIG 212 (226) T ss_pred CCHHHHHHHHHHHHHHH---CCCCCEEEECCCCCCCCHHHHHHHHHHHHHHHHCCCEEEEEEECHHHHHHCCEEEEEC T ss_conf 89999999999999973---8987168832873337989999999999999976998999972578998489999944 No 85 >cd03288 ABCC_SUR2 The SUR domain 2. The sulfonylurea receptor SUR is an ATP binding cassette (ABC) protein of the ABCC/MRP family. Unlike other ABC proteins, it has no intrinsic transport function, neither active nor passive, but associates with the potassium channel proteins Kir6.1 or Kir6.2 to form the ATP-sensitive potassium (K(ATP)) channel. Within the channel complex, SUR serves as a regulatory subunit that fine-tunes the gating of Kir6.x in response to alterations in cellular metabolism. It constitutes a major pharmaceutical target as it binds numerous drugs, K(ATP) channel openers and blockers, capable of up- or down-regulating channel activity. Probab=98.41 E-value=2.2e-06 Score=60.99 Aligned_cols=73 Identities=19% Similarity=0.207 Sum_probs=64.2 Q ss_pred HCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCEEEEECHHHHHHHCCCEEEEEE Q ss_conf 06215799999999984366899769980344688879999999999997305939998083798650176179999 Q gi|255764514|r 428 ASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSKKIQLLAVTHAPQVAARADRHFLVYK 504 (554) Q Consensus 428 aSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~~~Qvi~ITH~pqvAa~a~~h~~v~K 504 (554) +|||++-|++||=.++ .++|.+||||.=++++-.+...+-+.+..+.++.=||+|||-+..+..+|+=++..+ T Consensus 157 LSgGQrQri~lARAll----~~~~iliLDEpts~LD~~te~~i~~~l~~~~~~~TvI~ItHrl~~~~~~D~Iivl~~ 229 (257) T cd03288 157 FSVGQRQLFCLARAFV----RKSSILIMDEATASIDMATENILQKVVMTAFADRTVVTIAHRVSTILDADLVLVLSR 229 (257) T ss_pred CCHHHHHHHHHHHHHH----CCCCEEEEECCCCCCCHHHHHHHHHHHHHHCCCCEEEEEECCHHHHHHCCEEEEEEC T ss_conf 6999999999999995----599999995876678999999999999997499999999238989985999999989 No 86 >PRK13540 cytochrome c biogenesis protein CcmA; Provisional Probab=98.40 E-value=1.7e-06 Score=61.73 Aligned_cols=68 Identities=16% Similarity=0.110 Sum_probs=58.8 Q ss_pred HCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHH-HHCCCEEEEECHHHHHHHCCCE Q ss_conf 06215799999999984366899769980344688879999999999997-3059399980837986501761 Q gi|255764514|r 428 ASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQL-SKKIQLLAVTHAPQVAARADRH 499 (554) Q Consensus 428 aSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~l-s~~~Qvi~ITH~pqvAa~a~~h 499 (554) +|||++-|++||..++ .++|.++|||.-+|++-.+...+-+.++++ ++..=||+|||.+-...+||+- T Consensus 128 LSgGqkqrv~lar~l~----~~p~illLDEPt~gLD~~~~~~i~~~l~~~~~~g~tiii~sH~~~~l~~aD~~ 196 (200) T PRK13540 128 LSSGQKRQVALLRLWM----SKAKLWLLDEPLVALDELSLLTIITKIQEHRAKGGAVLLTSHQDLPLNKADYE 196 (200) T ss_pred CCHHHHHHHHHHHHHH----HCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCEEEEEECCHHHHHHCCHH T ss_conf 9999999999999998----39998999177643899999999999999986899999994264777768877 No 87 >cd03250 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C. This family is also known as MRP (mulrtidrug resisitance-associated protein). Some of the MRP members have five additional transmembrane segments in their N-terminas, but the function of these additional membrane-spanning domains is not clear. The MRP was found in the multidrug-resisting lung cancer cell in which p-glycoprotein was not overexpressed. MRP exports glutathione by drug stimulation, as well as, certain substrates in conjugated forms with anions, such as glutathione, glucuronate, and sulfate. Probab=98.39 E-value=2.2e-06 Score=60.97 Aligned_cols=72 Identities=24% Similarity=0.236 Sum_probs=57.9 Q ss_pred HCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHH-HHH-HHHHCCCEEEEECHHHHHHHCCCEEEEE Q ss_conf 062157999999999843668997699803446888799999999-999-9730593999808379865017617999 Q gi|255764514|r 428 ASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGY-RLK-QLSKKIQLLAVTHAPQVAARADRHFLVY 503 (554) Q Consensus 428 aSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~-~l~-~ls~~~Qvi~ITH~pqvAa~a~~h~~v~ 503 (554) +|||++-|+++|-.++ ..+|.++|||.=++++-.+...+=+ .++ ...+..=||+|||-+..+..||+-+.+. T Consensus 128 LSgGQkQRvalARal~----~~~~illlDEPts~LD~~~~~~i~~~l~~~~~~~~~Tvi~itH~~~~~~~~D~ii~l~ 201 (204) T cd03250 128 LSGGQKQRISLARAVY----SDADIYLLDDPLSAVDAHVGRHIFENCILGLLLNNKTRILVTHQLQLLPHADQIVVLD 201 (204) T ss_pred CCHHHHHHHHHHHHHH----CCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHCCCEEEEECCCHHHHHHCCEEEEEC T ss_conf 7999999999999995----3999999969876669999999999999998608989999807999997099999972 No 88 >cd03289 ABCC_CFTR2 The CFTR subfamily domain 2. The cystic fibrosis transmembrane regulator (CFTR), the product of the gene mutated in patients with cystic fibrosis, has adapted the ABC transporter structural motif to form a tightly regulated anion channel at the apical surface of many epithelia. Use of the term assembly of a functional ion channel implies the coming together of subunits or at least smaller not-yet functional components of the active whole. In fact, on the basis of current knowledge only the CFTR polypeptide itself is required to form an ATP- and protein kinase A-dependent low-conductance chloride channel of the type present in the apical membrane of many epithelial cells. CFTR displays the typical organization (IM-ABC)2 and carries a characteristic hydrophilic R-domain that separates IM1-ABC1 from IM2-ABC2. Probab=98.39 E-value=2.6e-06 Score=60.52 Aligned_cols=73 Identities=18% Similarity=0.214 Sum_probs=64.2 Q ss_pred HCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCEEEEECHHHHHHHCCCEEEEEE Q ss_conf 06215799999999984366899769980344688879999999999997305939998083798650176179999 Q gi|255764514|r 428 ASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSKKIQLLAVTHAPQVAARADRHFLVYK 504 (554) Q Consensus 428 aSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~~~Qvi~ITH~pqvAa~a~~h~~v~K 504 (554) +|||++-|++||=.++ ..++.+||||.-+|++-.+...+-+.|+++.++.=||+|||-+.....+|+=+++.+ T Consensus 139 LSgGqkQrl~lARaLl----~~p~IllLDEpTs~LD~~te~~i~~~l~~~~~~~TvI~itHrl~~~~~~DrIlvld~ 211 (275) T cd03289 139 LSHGHKQLMCLARSVL----SKAKILLLDEPSAHLDPITYQVIRKTLKQAFADCTVILSEHRIEAMLECQRFLVIEE 211 (275) T ss_pred CCHHHHHHHHHHHHHH----CCCCEEEEECCCCCCCHHHHHHHHHHHHHHCCCCEEEEEECCHHHHHHCCEEEEEEC T ss_conf 3999999999999995----199989997976689999999999999997299989999438888986999999989 No 89 >cd03225 ABC_cobalt_CbiO_domain1 Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota. The transition metal cobalt is an essential component of many enzymes and must be transported into cells in appropriate amounts when needed. This ABC transport system of the CbiMNQO family is involved in cobalt transport in association with the cobalamin (vitamin B12) biosynthetic pathways. Most of cobalt (Cbi) transport systems possess a separate CbiN component, the cobalt-binding periplasmic protein, and they are encoded by the conserved gene cluster cbiMNQO. Both the CbiM and CbiQ proteins are integral cytoplasmic membrane proteins, and the CbiO protein has the linker peptide and the Walker A and B motifs commonly found in the ATPase components of the ABC-type transport systems. Probab=98.39 E-value=3.3e-06 Score=59.85 Aligned_cols=72 Identities=26% Similarity=0.288 Sum_probs=60.7 Q ss_pred HCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCC-CEEEEECHHHHH-HHCCCEEEEE Q ss_conf 062157999999999843668997699803446888799999999999973059-399980837986-5017617999 Q gi|255764514|r 428 ASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSKKI-QLLAVTHAPQVA-ARADRHFLVY 503 (554) Q Consensus 428 aSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~~~-Qvi~ITH~pqvA-a~a~~h~~v~ 503 (554) +|||++=|+++|..++ ..++++||||.=+|++-.+...|-++|+++.+.. =||+|||-+-.| .+||+.+.+. T Consensus 135 LSGGqkQrv~iAral~----~~P~ililDEPTsgLD~~~~~~i~~~l~~l~~~g~tii~itHdl~~~~~~~dri~~m~ 208 (211) T cd03225 135 LSGGQKQRVAIAGVLA----MDPDILLLDEPTAGLDPAGRRELLELLKKLKAEGKTIIIVTHDLDLLLELADRVIVLE 208 (211) T ss_pred CCHHHHHHHHHHHHHH----CCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCEEEEEECCHHHHHHHCCEEEEEE T ss_conf 9998999999999997----5999999979855589999999999999999789999999259999999799999982 No 90 >cd03260 ABC_PstB_phosphate_transporter Phosphate uptake is of fundamental importance in the cell physiology of bacteria because phosphate is required as a nutrient. The Pst system of E. coli comprises four distinct subunits encoded by the pstS, pstA, pstB, and pstC genes. The PstS protein is a phosphate-binding protein located in the periplasmic space. P stA and PstC are hydrophobic and they form the transmembrane portion of the Pst system. PstB is the catalytic subunit, which couples the energy of ATP hydrolysis to the import of phosphate across cellular membranes through the Pst system, often referred as ABC-protein. PstB belongs to one of the largest superfamilies of proteins characterized by a highly conserved adenosine triphosphate (ATP) binding cassette (ABC), which is also a nucleotide binding domain (NBD). Probab=98.39 E-value=3.4e-06 Score=59.81 Aligned_cols=73 Identities=32% Similarity=0.403 Sum_probs=61.4 Q ss_pred HCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCEEEEECHHHHHHH-CCCEEEEEE Q ss_conf 06215799999999984366899769980344688879999999999997305939998083798650-176179999 Q gi|255764514|r 428 ASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSKKIQLLAVTHAPQVAAR-ADRHFLVYK 504 (554) Q Consensus 428 aSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~~~Qvi~ITH~pqvAa~-a~~h~~v~K 504 (554) +|||++=|+++|-.++ ..++.++|||.-++++-.+...|-+.++++.+..-+|+|||-...|.. ||+=++..+ T Consensus 142 LSGGq~QRvaIArAL~----~~P~iLllDEPTs~LD~~~~~~i~~li~~l~~~~Tii~vTHdl~~a~~~aDri~vl~~ 215 (227) T cd03260 142 LSGGQQQRLCLARALA----NEPEVLLLDEPTSALDPISTAKIEELIAELKKEYTIVIVTHNMQQAARVADRTAFLLN 215 (227) T ss_pred CCHHHHHHHHHHHHHH----CCCCEEEECCCCCCCCHHHHHHHHHHHHHHHHCCEEEEEECCHHHHHHHCCEEEEEEC T ss_conf 8999999999999983----5999999689876579899999999999996688899993699999986999999989 No 91 >cd03262 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-binding components of the bacterial periplasmic histidine and glutamine permeases, repectively. Histidine permease is a multisubunit complex containing the HisQ and HisM integral membrane subunits and two copies of HisP. HisP has properties intermediate between those of integral and peripheral membrane proteins and is accessible from both sides of the membrane, presumably by its interaction with HisQ and HisM. The two HisP subunits form a homodimer within the complex. The domain structure of the amino acid uptake systems is typical for prokaryote extracellular solute binding protein-dependent uptake systems. All of the amino acid uptake systems also have at least one, and in a few cases, two extracellular solute binding proteins located in the periplasm of Gram-negative bacteria, or attached to the cell membrane of Gram-positive bacteria. The best-studied member of the PAAT (polar amino acid transport) family is the HisJQM Probab=98.39 E-value=3.1e-06 Score=60.06 Aligned_cols=72 Identities=25% Similarity=0.325 Sum_probs=59.4 Q ss_pred HCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCC-EEEEECHHHHH-HHCCCEEEEE Q ss_conf 0621579999999998436689976998034468887999999999999730593-99980837986-5017617999 Q gi|255764514|r 428 ASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSKKIQ-LLAVTHAPQVA-ARADRHFLVY 503 (554) Q Consensus 428 aSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~~~Q-vi~ITH~pqvA-a~a~~h~~v~ 503 (554) +||||+=|+++|=.++ ..++.+++||.=++++..++..|-+.|+++.+... +|+|||-+..| .+||+-+... T Consensus 136 LSGGqqQRVAIARALa----~~P~ilL~DEPts~LD~~~~~~i~~ll~~l~~~g~T~i~VTHD~~~a~~~aDri~~l~ 209 (213) T cd03262 136 LSGGQQQRVAIARALA----MNPKVMLFDEPTSALDPELVGEVLDVMKDLAEEGMTMVVVTHEMGFAREVADRVIFMD 209 (213) T ss_pred CCCHHHHHHHHHHHHC----CCCCEEEECCCCCCCCHHHHHHHHHHHHHHHHCCCEEEEECCCHHHHHHHCCEEEEEE T ss_conf 6929999999999963----7999999708888779899999999999998629999999989999999689899997 No 92 >cd03217 ABC_FeS_Assembly ABC-type transport system involved in Fe-S cluster assembly, ATPase component. Biosynthesis of iron-sulfur clusters (Fe-S) depends on multiprotein systems. The SUF system of E. coli and Erwinia chrysanthemi is important for Fe-S biogenesis under stressful conditions. The SUF system is made of six proteins: SufC is an atypical cytoplasmic ABC-ATPase, which forms a complex with SufB and SufD; SufA plays the role of a scaffold protein for assembly of iron-sulfur clusters and delivery to target proteins; SufS is a cysteine desulfurase which mobilizes the sulfur atom from cysteine and provides it to the cluster; SufE has no associated function yet. Probab=98.39 E-value=2.2e-06 Score=60.99 Aligned_cols=73 Identities=25% Similarity=0.342 Sum_probs=60.4 Q ss_pred HCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHH-HCCCEEEEECHHHHHHH--CCCEEEEEE Q ss_conf 062157999999999843668997699803446888799999999999973-05939998083798650--176179999 Q gi|255764514|r 428 ASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLS-KKIQLLAVTHAPQVAAR--ADRHFLVYK 504 (554) Q Consensus 428 aSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls-~~~Qvi~ITH~pqvAa~--a~~h~~v~K 504 (554) +||||+-|+++|..++. .++.++|||.-+|++-.+...+.+.++++. +..-||+|||-+.++.+ ||+=+++.+ T Consensus 105 LSGGekqrv~iaral~~----~P~lllLDEPtsgLD~~~~~~i~~~i~~l~~~g~tiiiitH~~~~~~~~~~Drv~vl~~ 180 (200) T cd03217 105 FSGGEKKRNEILQLLLL----EPDLAILDEPDSGLDIDALRLVAEVINKLREEGKSVLIITHYQRLLDYIKPDRVHVLYD 180 (200) T ss_pred CCHHHHHHHHHHHHHHH----CCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCEEEEEEECHHHHHHHCCCEEEEEEC T ss_conf 79999999999999960----99999996962269999999999999999857999999996368776646999999879 No 93 >TIGR02857 CydD ABC transporter, CydDC cysteine exporter (CydDC-E) family, permease/ATP-binding protein CydD; InterPro: IPR014216 The gene pair cydCD encodes an ABC-family transporter in which each gene contains an N-terminal membrane-spanning domain and a C-terminal ATP-binding domain. In Escherichia coli these genes were discovered as mutants which caused the terminal heme-copper oxidase complex cytochrome bd to fail to assemble. Recent work has shown that the transporter is involved in the export of redox-active thiol compounds such as cysteine and glutathione , . The linkage to assembly of the cytochrome bd complex is further supported by the conserved operon structure found outside the gammaproteobacteria (cydABCD) containing both the transporter and oxidase genes components. The genes used as the seed members for this entry are all either found in the gammaproteobacterial context, or the CydABCD context. All members of this entry scoring above the trusted cut off at the time of its creation were from genomes which encode a cytochrome bd complex. Unfortunately, the gene symbol nomenclature, based on this operon in Bacillus subtilis, assigns cydC to the third gene in the operon, where this gene is actually homologous to the E. coli cydD gene. We have chosen to name all homologues in this family in accordance with the precedence of publication of the E. coli name, CydD.. Probab=98.38 E-value=1.4e-06 Score=62.32 Aligned_cols=73 Identities=29% Similarity=0.334 Sum_probs=62.8 Q ss_pred HHCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHH-HCCCEEEEECHHHHHHHCCCEE Q ss_conf 4062157999999999843668997699803446888799999999999973-0593999808379865017617 Q gi|255764514|r 427 LASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLS-KKIQLLAVTHAPQVAARADRHF 500 (554) Q Consensus 427 iaSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls-~~~Qvi~ITH~pqvAa~a~~h~ 500 (554) -+||||.=|++||=-|+=.... .|.++|||-=|+++..|...|=+-+++++ +.+=||+|||.+.++..+|+=+ T Consensus 495 GLSGGq~QRlALARafl~~~~a-~~llLLDEPTAhLD~~tEa~v~~~~~~l~A~grtvl~v~Hr~~~~~~aD~iv 568 (570) T TIGR02857 495 GLSGGQAQRLALARAFLRDATA-APLLLLDEPTAHLDAETEAEVLEALRALAAQGRTVLLVTHRLALAALADRIV 568 (570) T ss_pred CCCHHHHHHHHHHHHHHCHHHC-CCCEEEECCCCCCCHHHHHHHHHHHHHHHHCCCEEEEEECCHHHHHHCCEEE T ss_conf 4779999999999996061111-7603540776432189999999999999737988999976689993274021 No 94 >PRK13539 cytochrome c biogenesis protein CcmA; Provisional Probab=98.38 E-value=1.1e-06 Score=63.02 Aligned_cols=66 Identities=23% Similarity=0.253 Sum_probs=56.4 Q ss_pred HCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHC-CCEEEEECHHHHHHHCC Q ss_conf 06215799999999984366899769980344688879999999999997305-93999808379865017 Q gi|255764514|r 428 ASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSKK-IQLLAVTHAPQVAARAD 497 (554) Q Consensus 428 aSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~~-~Qvi~ITH~pqvAa~a~ 497 (554) +|||++-|+++|..++ .+.+.+|+||.-+|++-.+...|-+.++++.+. .=||++||.|.=...|+ T Consensus 127 LSgG~kqrv~la~al~----~~p~vllLDEPtsgLD~~~~~~v~~~i~~~~~~g~tiIi~tH~p~~~~~~~ 193 (206) T PRK13539 127 LSAGQKRRVALARLLV----SNRPIWLLDEPTAALDSASQALFAELIRAHLAQGGIVIAATHIPLGLPGAR 193 (206) T ss_pred CCHHHHHHHHHHHHHH----HCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCEEEEEECCCCCCCCCC T ss_conf 9999999999999998----698989997997778999999999999999958999999938988788898 No 95 >PRK13648 cbiO cobalt transporter ATP-binding subunit; Provisional Probab=98.38 E-value=2.7e-06 Score=60.50 Aligned_cols=73 Identities=19% Similarity=0.279 Sum_probs=61.5 Q ss_pred HCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCC--CEEEEECHHHHHHHCCCEEEEEE Q ss_conf 062157999999999843668997699803446888799999999999973059--39998083798650176179999 Q gi|255764514|r 428 ASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSKKI--QLLAVTHAPQVAARADRHFLVYK 504 (554) Q Consensus 428 aSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~~~--Qvi~ITH~pqvAa~a~~h~~v~K 504 (554) +|||++=|+++|-.++ ..++.+||||.=+|++-.+...+-+.|+++.+.. =||+|||-...|..||+=++..+ T Consensus 143 LSGGqkQRvaiAraL~----~~P~iLilDEPTs~LD~~~~~~i~~ll~~L~~~~~~TvI~itHdl~~a~~aDrvivl~~ 217 (269) T PRK13648 143 LSGGQKQRVAIASVLA----LNPSVIILDEATSMLDPDARQNLLDLVRKVKSEHNITIISITHDLSEAMEADHVIVMNK 217 (269) T ss_pred CCHHHHHHHHHHHHHH----HCCCEEEECCCCCCCCHHHHHHHHHHHHHHHHCCCCEEEEEEECHHHHHHCCEEEEEEC T ss_conf 8999999999999997----59899998187554899999999999999997379899999767899971998999989 No 96 >cd03213 ABCG_EPDR ABCG transporters are involved in eye pigment (EP) precursor transport, regulation of lipid-trafficking mechanisms, and pleiotropic drug resistance (DR). DR is a well-described phenomenon occurring in fungi and shares several similarities with processes in bacteria and higher eukaryotes. Compared to other members of the ABC transporter subfamilies, the ABCG transporter family is composed of proteins that have an ATP-binding cassette domain at the N-terminus and a TM (transmembrane) domain at the C-terminus. Probab=98.37 E-value=3e-06 Score=60.13 Aligned_cols=73 Identities=27% Similarity=0.419 Sum_probs=61.2 Q ss_pred HCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHC-CCEEEEECHH--HHHHHCCCEEEEEE Q ss_conf 06215799999999984366899769980344688879999999999997305-9399980837--98650176179999 Q gi|255764514|r 428 ASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSKK-IQLLAVTHAP--QVAARADRHFLVYK 504 (554) Q Consensus 428 aSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~~-~Qvi~ITH~p--qvAa~a~~h~~v~K 504 (554) +||||+=|+++|..++ ..++.++|||.-+|++-.+...|-+.|+++++. .=||++||.| .+...+|+=+.+.+ T Consensus 112 LSgGqrqRv~iA~aL~----~~P~illlDEPTsgLD~~~~~~i~~~l~~l~~~g~tvi~~tH~~~~~~~~~~Drv~vl~~ 187 (194) T cd03213 112 LSGGERKRVSIALELV----SNPSLLFLDEPTSGLDSSSALQVMSLLRRLADTGRTIICSIHQPSSEIFELFDKLLLLSQ 187 (194) T ss_pred CCHHHHHHHHHHHHHH----CCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHCCEEEEEEC T ss_conf 8889999999999996----399889994898788989999999999999968989999958885999997999999989 No 97 >PRK13642 cbiO cobalt transporter ATP-binding subunit; Provisional Probab=98.36 E-value=3.5e-06 Score=59.70 Aligned_cols=73 Identities=26% Similarity=0.324 Sum_probs=60.9 Q ss_pred HCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCC--CEEEEECHHHHHHHCCCEEEEEE Q ss_conf 062157999999999843668997699803446888799999999999973059--39998083798650176179999 Q gi|255764514|r 428 ASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSKKI--QLLAVTHAPQVAARADRHFLVYK 504 (554) Q Consensus 428 aSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~~~--Qvi~ITH~pqvAa~a~~h~~v~K 504 (554) +|||++=|+++|..++. .++.+|+||.=+|++-.+...|-+.|++|.+.. =||+|||-...|+.||+=++..+ T Consensus 141 LSGGqrQRvaIA~aLa~----~P~ililDEPTs~LD~~~~~~i~~ll~~L~~~~~~Tii~iTHdl~~~~~aDrv~vm~~ 215 (277) T PRK13642 141 LSGGQKQRVAVAGIIAL----RPEIIILDESTSMLDPTGRSEIMRVIHEIKDKYHLTVLSITHDLDEAASSDRILVMRA 215 (277) T ss_pred CCHHHHHHHHHHHHHHC----CCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHCCCEEEEEEECHHHHHHCCEEEEEEC T ss_conf 89999999999999966----9999999588765898999999999999998169899999458899971998999989 No 98 >COG1132 MdlB ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms] Probab=98.36 E-value=2.8e-06 Score=60.36 Aligned_cols=73 Identities=27% Similarity=0.373 Sum_probs=63.4 Q ss_pred HCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCEEEEECHHHHHHHCCCEEEEEE Q ss_conf 06215799999999984366899769980344688879999999999997305939998083798650176179999 Q gi|255764514|r 428 ASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSKKIQLLAVTHAPQVAARADRHFLVYK 504 (554) Q Consensus 428 aSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~~~Qvi~ITH~pqvAa~a~~h~~v~K 504 (554) +||||+=|+++|=.+. .++|.+||||-=++++-.+-..+-+.+.++.++..+|+|+|-|.....||.=+++.+ T Consensus 466 LSgGQrQriaiARall----~~~~iLILDEaTS~lD~~tE~~I~~~l~~l~~~rT~iiIaHRlsti~~aD~IiVl~~ 538 (567) T COG1132 466 LSGGQRQRLAIARALL----RNPPILILDEATSALDTETEALIQDALKKLLKGRTTLIIAHRLSTIKNADRIIVLDN 538 (567) T ss_pred CCHHHHHHHHHHHHHH----HCCCEEEECCHHHCCCHHHHHHHHHHHHHHHCCCEEEEEECCCCHHHHCCEEEEEEC T ss_conf 8899999999999970----369868872311026775699999999998269879998667225874888999758 No 99 >TIGR01978 sufC FeS assembly ATPase SufC; InterPro: IPR010230 Iron-sulphur (FeS) clusters are important cofactors for numerous proteins involved in electron transfer, in redox and non-redox catalysis, in gene regulation, and as sensors of oxygen and iron. These functions depend on the various FeS cluster prosthetic groups, the most common being [2Fe-2S] and [4Fe-4S] . FeS cluster assembly is a complex process involving the mobilisation of Fe and S atoms from storage sources, their assembly into [Fe-S] form, their transport to specific cellular locations, and their transfer to recipient apoproteins. So far, three FeS assembly machineries have been identified, which are capable of synthesising all types of [Fe-S] clusters: ISC (iron-sulphur cluster), SUF (sulphur assimilation), and NIF (nitrogen fixation) systems. The ISC system is conserved in eubacteria and eukaryotes (mitochondria), and has broad specificity, targeting general FeS proteins , . It is encoded by the isc operon (iscRSUA-hscBA-fdx-iscX). IscS is a cysteine desulphurase, which obtains S from cysteine (converting it to alanine) and serves as a S donor for FeS cluster assembly. IscU and IscA act as scaffolds to accept S and Fe atoms, assembling clusters and transfering them to recipient apoproteins. HscA is a molecular chaperone and HscB is a co-chaperone. Fdx is a [2Fe-2S]-type ferredoxin. IscR is a transcription factor that regulates expression of the isc operon. IscX (also known as YfhJ) appears to interact with IscS and may function as an Fe donor during cluster assembly . The SUF system is an alternative pathway to the ISC system that operates under iron starvation and oxidative stress. It is found in eubacteria, archaea and eukaryotes (plastids). The SUF system is encoded by the suf operon (sufABCDSE), and the six encoded proteins are arranged into two complexes (SufSE and SufBCD) and one protein (SufA). SufS is a pyridoxal-phosphate (PLP) protein displaying cysteine desulphurase activity. SufE acts as a scaffold protein that accepts S from SufS and donates it to SufA . SufC is an ATPase with an unorthodox ATP-binding cassette (ABC)-like component. No specific functions have been assigned to SufB and SufD. SufA is homologous to IscA , acting as a scaffold protein in which Fe and S atoms are assembled into [FeS] cluster forms, which can then easily be transferred to apoproteins targets. In the NIF system, NifS and NifU are required for the formation of metalloclusters of nitrogenase in Azotobacter vinelandii, and other organisms, as well as in the maturation of other FeS proteins. Nitrogenase catalyses the fixation of nitrogen. It contains a complex cluster, the FeMo cofactor, which contains molybdenum, Fe and S. NifS is a cysteine desulphurase. NifU binds one Fe atom at its N-terminal, assembling an FeS cluster that is transferred to nitrogenase apoproteins . Nif proteins involved in the formation of FeS clusters can also be found in organisms that do not fix nitrogen . This entry represents SufC, which acts as an ATPase in the SUF system. SufC belongs to the ATP-binding cassette transporter family (IPR003439 from INTERPRO) but is no longer thought to be part of a transporter. The complex is reported as cytosolic or associated with the membrane.; GO: 0005524 ATP binding, 0006810 transport. Probab=98.35 E-value=2.7e-06 Score=60.40 Aligned_cols=61 Identities=25% Similarity=0.390 Sum_probs=35.1 Q ss_pred CCHHHHHHH-HHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHC---CCEEEEECHHHHHH Q ss_conf 621579999-9999984366899769980344688879999999999997305---93999808379865 Q gi|255764514|r 429 SGGELSRFL-LALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSKK---IQLLAVTHAPQVAA 494 (554) Q Consensus 429 SGGE~Sr~~-LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~~---~Qvi~ITH~pqvAa 494 (554) |||||=|.= |=+.+ ..| .++|+||+|+|++=-+...|++-+.++... +=||+|||=+.+=- T Consensus 149 SGGEKKrnEILQm~~----L~P-~laiLDE~DSGLDiDALk~V~~~in~lr~~~P~~~~liiTHY~rlL~ 213 (248) T TIGR01978 149 SGGEKKRNEILQMAL----LEP-KLAILDEIDSGLDIDALKIVAEGINRLREEHPDRAFLIITHYQRLLN 213 (248) T ss_pred CCCCCHHHHHHHHHH----CCC-CEEEEECCCCCCCHHHHHHHHHHHHHHHCCCCCCEEEEEECHHHHHH T ss_conf 387115768998875----199-57986068887637888999999998730689800899875178841 No 100 >PRK11831 putative ABC transporter ATP-binding protein YrbF; Provisional Probab=98.35 E-value=4.5e-06 Score=58.96 Aligned_cols=73 Identities=26% Similarity=0.316 Sum_probs=62.6 Q ss_pred HCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHH--CCCEEEEEC-HHHHHHHCCCEEEEEE Q ss_conf 0621579999999998436689976998034468887999999999999730--593999808-3798650176179999 Q gi|255764514|r 428 ASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSK--KIQLLAVTH-APQVAARADRHFLVYK 504 (554) Q Consensus 428 aSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~--~~Qvi~ITH-~pqvAa~a~~h~~v~K 504 (554) +|||++=|+++|-.++ ..++.++|||.=+|++-.+...+-+.|+++.+ ..=||+||| ++.|...||+=++... T Consensus 145 LSGGq~QRv~iAraL~----~~P~iLlLDEPtsgLD~~~~~~i~~li~~l~~~~g~TiiivtHdl~~v~~iaDrv~vl~~ 220 (269) T PRK11831 145 LSGGMARRAALARAIA----LEPDLIMFDEPFVGQDPITMGVLVKLISELNSALGVTCVVVSHDVPEVLSIADHAWIVAD 220 (269) T ss_pred CCHHHHHHHHHHHHHH----CCCCEEEECCCCCCCCHHHHHHHHHHHHHHHHHCCCEEEEECCCHHHHHHHCCEEEEEEC T ss_conf 8999999999999997----599999982875679999999999999999985298999986498999986999999989 No 101 >COG1121 ZnuC ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism] Probab=98.34 E-value=3.8e-06 Score=59.47 Aligned_cols=81 Identities=31% Similarity=0.301 Sum_probs=64.2 Q ss_pred HHHHHHCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHH-CCCEEEEECH-HHHHHHCCCEE Q ss_conf 135440621579999999998436689976998034468887999999999999730-5939998083-79865017617 Q gi|255764514|r 423 PLMKLASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSK-KIQLLAVTHA-PQVAARADRHF 500 (554) Q Consensus 423 pl~kiaSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~-~~Qvi~ITH~-pqvAa~a~~h~ 500 (554) |+.++ |||++-|+.||-.++ .++..+++||-=+||+-.+...+-++|+++.+ ..=|++|||= -.|.++.|+-+ T Consensus 136 ~i~~L-SGGQ~QRV~lARAL~----~~p~lllLDEP~~gvD~~~~~~i~~lL~~l~~eg~tIl~vtHDL~~v~~~~D~vi 210 (254) T COG1121 136 QIGEL-SGGQKQRVLLARALA----QNPDLLLLDEPFTGVDVAGQKEIYDLLKELRQEGKTVLMVTHDLGLVMAYFDRVI 210 (254) T ss_pred CCCCC-CCHHHHHHHHHHHHC----CCCCEEEECCCCCCCCHHHHHHHHHHHHHHHHCCCEEEEEECCCHHHHHHCCEEE T ss_conf 55546-727999999999853----6999899668754579878999999999998789889999588177685388799 Q ss_pred EEEEEECC Q ss_conf 99996216 Q gi|255764514|r 501 LVYKTNKP 508 (554) Q Consensus 501 ~v~K~~~~ 508 (554) .+.|.... T Consensus 211 ~Ln~~~~~ 218 (254) T COG1121 211 CLNRHLIA 218 (254) T ss_pred EECCEEEE T ss_conf 98576366 No 102 >cd03235 ABC_Metallic_Cations ABC component of the metal-type transporters. This family includes transporters involved in the uptake of various metallic cations such as iron, manganese, and zinc. The ATPases of this group of transporters are very similar to members of iron-siderophore uptake family suggesting that they share a common ancestor. The best characterized metal-type ABC transporters are the YfeABCD system of Y. pestis, the SitABCD system of Salmonella enterica serovar Typhimurium, and the SitABCD transporter of Shigella flexneri. Moreover other uncharacterized homologs of these metal-type transporters are mainly found in pathogens like Haemophilus or enteroinvasive E. coli isolates. Probab=98.34 E-value=5.3e-06 Score=58.53 Aligned_cols=71 Identities=31% Similarity=0.428 Sum_probs=59.3 Q ss_pred HCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHC-CCEEEEECHHHHH-HHCCCEEEE Q ss_conf 06215799999999984366899769980344688879999999999997305-9399980837986-501761799 Q gi|255764514|r 428 ASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSKK-IQLLAVTHAPQVA-ARADRHFLV 502 (554) Q Consensus 428 aSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~~-~Qvi~ITH~pqvA-a~a~~h~~v 502 (554) +||||+-|+++|-.++ ..++.++|||.=+|++-.+...|-++|+++.+. .-||+|||-...| .++|+=+.+ T Consensus 133 LSgGqkQRv~iAraL~----~~P~lLlLDEPtsgLD~~~~~~~~~~i~~l~~~g~tii~vtHdl~~~~~~~drii~l 205 (213) T cd03235 133 LSGGQQQRVLLARALV----QDPDLLLLDEPFAGVDPKTQEDIYELLRELRREGMTILVVTHDLGLVLEYFDRVLLL 205 (213) T ss_pred CCHHHHHHHHHHHHHH----CCCCEEEECCCCCCCCHHHHHHHHHHHHHHHHCCCEEEEEECCHHHHHHHCCEEEEE T ss_conf 7989999999999996----699999981886678999999999999999968999999907989999979999999 No 103 >PRK09984 phosphonate/organophosphate ester transporter subunit; Provisional Probab=98.33 E-value=5.1e-06 Score=58.64 Aligned_cols=100 Identities=16% Similarity=0.222 Sum_probs=73.3 Q ss_pred HHCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHC--CCEEEEECHHHHHHHCCCEEEEEE Q ss_conf 406215799999999984366899769980344688879999999999997305--939998083798650176179999 Q gi|255764514|r 427 LASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSKK--IQLLAVTHAPQVAARADRHFLVYK 504 (554) Q Consensus 427 iaSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~~--~Qvi~ITH~pqvAa~a~~h~~v~K 504 (554) -+||||+=|+++|-.++ ..++.++|||.=+|++-..+..+-++|+++.+. .=||+|||-...|..=-.++.|-+ T Consensus 152 ~LSGGqkQRv~IArAL~----~~P~iLllDEPta~LDp~~~~~i~~~l~~l~~~~g~Til~vtHdl~~a~~~~Dri~vl~ 227 (262) T PRK09984 152 TLSGGQQQRVAIARALM----QQAKVILADEPIASLDPESARIVMDTLRDINQNDGITVVVTLHQVDYALRYCERIVALR 227 (262) T ss_pred HCCHHHHHHHHHHHHHH----CCCCEEEECCCCCCCCHHHHHHHHHHHHHHHHHCCCEEEEECCCHHHHHHHCCEEEEEE T ss_conf 48999999999999997----19999998388677999999999999999998549799998889899999699999996 Q ss_pred EECCCCCCEEEEEEEECCHHHHHHHHHHHHC Q ss_conf 6216875258999997598899999999866 Q gi|255764514|r 505 TNKPDDTQRIETYVAVLTPQERREEIARMLA 535 (554) Q Consensus 505 ~~~~~~~~~~~~~i~~l~~~~r~~Eiarml~ 535 (554) ...= ........+ .++++.++=++++ T Consensus 228 ~G~i----i~~G~~eel-~~e~~~~~y~~~~ 253 (262) T PRK09984 228 QGHV----FYDGSSQQF-DNERFDHLYRSIN 253 (262) T ss_pred CCEE----EEECCHHHH-CCHHHHHHHHHHH T ss_conf 9999----998597896-8763899998887 No 104 >cd03234 ABCG_White The White subfamily represents ABC transporters homologous to the Drosophila white gene, which acts as a dimeric importer for eye pigment precursors. The eye pigmentation of Drosophila is developed from the synthesis and deposition in the cells of red pigments, which are synthesized from guanine, and brown pigments, which are synthesized from tryptophan. The pigment precursors are encoded by the white, brown, and scarlet genes, respectively. Evidence from genetic and biochemical studies suggest that the White and Brown proteins function as heterodimers to import guanine, while the White and Scarlet proteins function to import tryptophan. However, a recent study also suggests that White may be involved in the transport of a metabolite, such as 3-hydroxykynurenine, across intracellular membranes. Mammalian ABC transporters belonging to the White subfamily (ABCG1, ABCG5, and ABCG8) have been shown to be involved in the regulation of lipid-trafficking mechanisms in Probab=98.33 E-value=4.4e-06 Score=59.05 Aligned_cols=73 Identities=27% Similarity=0.374 Sum_probs=59.6 Q ss_pred HCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHH-CCCEEEEECHH--HHHHHCCCEEEEEE Q ss_conf 0621579999999998436689976998034468887999999999999730-59399980837--98650176179999 Q gi|255764514|r 428 ASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSK-KIQLLAVTHAP--QVAARADRHFLVYK 504 (554) Q Consensus 428 aSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~-~~Qvi~ITH~p--qvAa~a~~h~~v~K 504 (554) +||||+=|+++|..++ ..++.+++||.-+|++-.++..+-+.|+++++ ..=||++||.| .+..++|+=+...+ T Consensus 144 LSGGqrqRv~iA~aL~----~~P~illLDEPTsgLD~~~~~~i~~~l~~l~~~~~~vi~~~H~~~~~~~~~~Drv~vl~~ 219 (226) T cd03234 144 ISGGERRRVSIAVQLL----WDPKVLILDEPTSGLDSFTALNLVSTLSQLARRNRIVILTIHQPRSDLFRLFDRILLLSS 219 (226) T ss_pred CCHHHHHHHHHHHHHH----CCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHCCEEEEEEC T ss_conf 8999999999999996----599989995886568999999999999999978999999988898999997999999959 No 105 >PRK13649 cbiO cobalt transporter ATP-binding subunit; Provisional Probab=98.33 E-value=4.9e-06 Score=58.72 Aligned_cols=73 Identities=27% Similarity=0.342 Sum_probs=60.2 Q ss_pred HCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHC-CCEEEEECHH-HHHHHCCCEEEEEE Q ss_conf 06215799999999984366899769980344688879999999999997305-9399980837-98650176179999 Q gi|255764514|r 428 ASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSKK-IQLLAVTHAP-QVAARADRHFLVYK 504 (554) Q Consensus 428 aSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~~-~Qvi~ITH~p-qvAa~a~~h~~v~K 504 (554) +|||++=|+++|-.++ ..+..+||||.-+|++-.+...+-+.|+++.+. .-||+|||-. .|+.+||+=++..+ T Consensus 146 LSGGqkqRvaiA~aL~----~~P~iLllDEPTsgLDp~~~~~i~~ll~~l~~~G~Tii~vTHdl~~v~~~aDrv~vl~~ 220 (280) T PRK13649 146 LSGGQMRRVAIAGILA----MEPKILVLDEPTAGLDPKGRKELMTIFKKLHQSGMTIVLVTHLMDDVANYADFVYVLEK 220 (280) T ss_pred CCHHHHHHHHHHHHHH----CCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCEEEEECCCHHHHHHHCCEEEEEEC T ss_conf 9999999999999997----49999998487554899999999999999986399999987589999997999999989 No 106 >cd03257 ABC_NikE_OppD_transporters The ABC transporter subfamily specific for the transport of dipeptides, oligopeptides (OppD), and nickel (NikDE). The NikABCDE system of E. coli belongs to this family and is composed of the periplasmic binding protein NikA, two integral membrane components (NikB and NikC), and two ATPase (NikD and NikE). The NikABCDE transporter is synthesized under anaerobic conditions to meet the increased demand for nickel resulting from hydrogenase synthesis. The molecular mechanism of nickel uptake in many bacteria and most archaea is not known. Many other members of this ABC family are also involved in the uptake of dipeptides and oligopeptides. The oligopeptide transport system (Opp) is a five-component ABC transport composed of a membrane-anchored substrate binding proteins (SRP), OppA, two transmembrane proteins, OppB and OppC, and two ATP-binding domains, OppD and OppF. Probab=98.32 E-value=3.2e-06 Score=59.97 Aligned_cols=73 Identities=33% Similarity=0.392 Sum_probs=61.2 Q ss_pred HCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHC--CCEEEEECHHHHHHH-CCCEEEEEE Q ss_conf 06215799999999984366899769980344688879999999999997305--939998083798650-176179999 Q gi|255764514|r 428 ASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSKK--IQLLAVTHAPQVAAR-ADRHFLVYK 504 (554) Q Consensus 428 aSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~~--~Qvi~ITH~pqvAa~-a~~h~~v~K 504 (554) +||||+=|+++|-.++ ..++++++||.=+|++-.+...|-+.|+++.+. .=||+|||-+..|.. ||+=++..+ T Consensus 146 LSGGq~QRv~iAraL~----~~P~iLllDEPTs~LD~~~~~~i~~~l~~l~~~~~~tii~vtHd~~~~~~~aDrv~vm~~ 221 (228) T cd03257 146 LSGGQRQRVAIARALA----LNPKLLIADEPTSALDVSVQAQILDLLKKLQEELGLTLLFITHDLGVVAKIADRVAVMYA 221 (228) T ss_pred CCHHHHHHHHHHHHCC----CCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHCCCEEEEECCCHHHHHHHCCEEEEEEC T ss_conf 7988999999821104----799999994887647999999999999999985098999986899999996999999979 No 107 >PRK09580 sufC cysteine desulfurase ATPase component; Reviewed Probab=98.31 E-value=5.3e-06 Score=58.51 Aligned_cols=73 Identities=25% Similarity=0.244 Sum_probs=57.4 Q ss_pred HCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHH-CCCEEEEECHHHHHHH-CCCEEEEEE Q ss_conf 0621579999999998436689976998034468887999999999999730-5939998083798650-176179999 Q gi|255764514|r 428 ASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSK-KIQLLAVTHAPQVAAR-ADRHFLVYK 504 (554) Q Consensus 428 aSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~-~~Qvi~ITH~pqvAa~-a~~h~~v~K 504 (554) +||||+-|+++|..++. .++.+||||.-+|++-.+...+.+.++++.+ ..=||+|||.+.+++. +-.|..|-+ T Consensus 146 lSGGqkqRv~iaral~~----~P~lllLDEPtsgLD~~~~~~i~~~i~~l~~~~~tviivtH~~~~~~~~~~Dri~vl~ 220 (248) T PRK09580 146 FSGGEKKRNDILQMAVL----EPELCILDESDSGLDIDALKIVADGVNSLRDGKRSFIIVTHYQRILDYIKPDYVHVLY 220 (248) T ss_pred CCHHHHHHHHHHHHHHH----CCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCEEEEEEECHHHHHHHCCCEEEEEE T ss_conf 89889999999999976----8998999796223999999999999999983899999999874878767399999998 No 108 >PRK13538 cytochrome c biogenesis protein CcmA; Provisional Probab=98.31 E-value=5.1e-06 Score=58.63 Aligned_cols=71 Identities=20% Similarity=0.197 Sum_probs=57.9 Q ss_pred HCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHC-CCEEEEECHHHHHHHCCCEEEEE Q ss_conf 06215799999999984366899769980344688879999999999997305-93999808379865017617999 Q gi|255764514|r 428 ASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSKK-IQLLAVTHAPQVAARADRHFLVY 503 (554) Q Consensus 428 aSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~~-~Qvi~ITH~pqvAa~a~~h~~v~ 503 (554) +|||++-|++||-.++ .+++.++|||.-+|++-.....+-++|+++.+. .=||++||. -+.+.||+=+.+. T Consensus 130 LSgGqkqRv~lAral~----~~p~lllLDEPt~~LD~~~~~~l~~~l~~~~~~g~~vi~~tH~-dl~~~ad~v~vl~ 201 (204) T PRK13538 130 LSAGQQRRVALARLWL----TRAPLWILDEPFTAIDKQGVARLEQLLAQHAEQGGMVILTTHQ-DLPGASDKVRKLR 201 (204) T ss_pred CCHHHHHHHHHHHHHH----CCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCEEEEEECH-HHHHHCCEEEEEC T ss_conf 8999999999999996----0999899978865789999999999999998589989999866-9898769999973 No 109 >TIGR02315 ABC_phnC phosphonate ABC transporter, ATP-binding protein; InterPro: IPR012693 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems. ABC transporters are minimally constituted of two conserved regions: a highly conserved ATP binding cassette (ABC) and a less conserved transmembrane domain (TMD). These regions can be found on the same protein or on two different ones. Most ABC transporters function as a dimer and therefore are constituted of four domains, two ABC modules and two TMDs. ABC transporters are involved in the export or import of a wide variety of substrates ranging from small ions to macromolecules. The major function of ABC import systems is to provide essential nutrients to bacteria. They are found only in prokaryotes and their four constitutive domains are usually encoded by independent polypeptides (two ABC proteins and two TMD proteins). Prokaryotic importers require additional extracytoplasmic binding proteins (one or more per systems) for function. In contrast, export systems are involved in the extrusion of noxious substances, the export of extracellular toxins and the targeting of membrane components. They are found in all living organisms and in general the TMD is fused to the ABC module in a variety of combinations. Some eukaryotic exporters encode the four domains on the same polypeptide chain . The ABC module (approximately two hundred amino acid residues) is known to bind and hydrolyze ATP, thereby coupling transport to ATP hydrolysis in a large number of biological processes. The cassette is duplicated in several subfamilies. Its primary sequence is highly conserved, displaying a typical phosphate-binding loop: Walker A, and a magnesium binding site: Walker B. Besides these two regions, three other conserved motifs are present in the ABC cassette: the switch region which contains a histidine loop, postulated to polarize the attaching water molecule for hydrolysis, the signature conserved motif (LSGGQ) specific to the ABC transporter, and the Q-motif (between Walker A and the signature), which interacts with the gamma phosphate through a water bond. The Walker A, Walker B, Q-loop and switch region form the nucleotide binding site , , . The 3D structure of a monomeric ABC module adopts a stubby L-shape with two distinct arms. ArmI (mainly beta-strand) contains Walker A and Walker B. The important residues for ATP hydrolysis and/or binding are located in the P-loop. The ATP-binding pocket is located at the extremity of armI. The perpendicular armII contains mostly the alpha helical subdomain with the signature motif. It only seems to be required for structural integrity of the ABC module. ArmII is in direct contact with the TMD. The hinge between armI and armII contains both the histidine loop and the Q-loop, making contact with the gamma phosphate of the ATP molecule. ATP hydrolysis leads to a conformational change that could facilitate ADP release. In the dimer the two ABC cassettes contact each other through hydrophobic interactions at the antiparallel beta-sheet of armI by a two-fold axis , , , , , . Proteins known to belong to this family are classified in several functional subfamilies depending on the substrate used (for further information see http://www.tcdb.org/tcdb/index.php?tc=3.A.1). Phosphonates are a class of phosphorus-containing organic compound with a stable direct C-P bond rather than a C-O-P linkage. A number of bacterial species have operons, typically about 14 genes in size, with genes for ATP-dependent transport of phosphonates, degradation, and regulation of the expression of the system. Members of this protein family are the ATP-binding cassette component of tripartite ABC transporters of phosphonates.; GO: 0005524 ATP binding, 0015416 phosphonate transmembrane-transporting ATPase activity, 0015716 phosphonate transport, 0016020 membrane. Probab=98.31 E-value=1e-06 Score=63.29 Aligned_cols=41 Identities=22% Similarity=0.524 Sum_probs=34.2 Q ss_pred EEEEEEEEECCCC-EEEEECCCCCCHHHHHHHHHHHH-CCCCC Q ss_conf 7899998873898-18998899978889999999871-47325 Q gi|255764514|r 10 VLIESLDIDFSAG-LSILSGDTGSGKSILLDALILVT-GGRGD 50 (554) Q Consensus 10 ~~i~~~~i~f~~G-l~vItGetGaGKS~ildAl~~~l-G~r~~ 50 (554) ..++++++++.|| |++|+||+|||||+||-.|+=+- |.|.+ T Consensus 16 ~~LK~inl~i~~GE~~~~IG~SGAGKSTLLR~iNrL~~Gdk~~ 58 (253) T TIGR02315 16 QALKNINLEINPGEFVAVIGPSGAGKSTLLRCINRLVEGDKPS 58 (253) T ss_pred EEEEEECCEEECCEEEEEECCCCCCHHHHHHHHHHHCCCCCCC T ss_conf 7885311434165179997378872679998775302688887 No 110 >PRK10418 nikD nickel transporter ATP-binding protein; Provisional Probab=98.31 E-value=6.2e-06 Score=58.05 Aligned_cols=74 Identities=28% Similarity=0.370 Sum_probs=60.3 Q ss_pred HCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCC--EEEEECHHHHHHHCCCEEEEEEE Q ss_conf 0621579999999998436689976998034468887999999999999730593--99980837986501761799996 Q gi|255764514|r 428 ASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSKKIQ--LLAVTHAPQVAARADRHFLVYKT 505 (554) Q Consensus 428 aSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~~~Q--vi~ITH~pqvAa~a~~h~~v~K~ 505 (554) +|||++=|+++|..++. .++.+|+||.=+|++-.+...|-+.|+++.+... +|+|||-..+|..--.++.|-+. T Consensus 141 LSGGq~QRvaiArAL~~----~P~lLilDEPTs~LD~~~~~~il~ll~~l~~~~g~tii~vTHDl~~a~~~aDri~Vm~~ 216 (254) T PRK10418 141 MSGGMLQRMMIALALLC----EAPFIIADEPTTDLDVVAQARILDLLESIVQKRALGMLLVTHDMGVVARLADDVAVMSH 216 (254) T ss_pred CCHHHHHHHHHHHHHHC----CCCEEEECCCCCCCCHHHHHHHHHHHHHHHHHHCCEEEEEECCHHHHHHHCCEEEEEEC T ss_conf 48799999999999854----99989855875437999999999999999997099799996999999996899999989 No 111 >cd03292 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane. The FtsE/X transporter is thought to be involved in cell division and is important for assembly or stability of the septal ring. Probab=98.31 E-value=5.6e-06 Score=58.34 Aligned_cols=72 Identities=28% Similarity=0.318 Sum_probs=59.7 Q ss_pred HCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHH-CCCEEEEECHHHHH-HHCCCEEEEE Q ss_conf 0621579999999998436689976998034468887999999999999730-59399980837986-5017617999 Q gi|255764514|r 428 ASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSK-KIQLLAVTHAPQVA-ARADRHFLVY 503 (554) Q Consensus 428 aSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~-~~Qvi~ITH~pqvA-a~a~~h~~v~ 503 (554) +||||+=|+++|=.++ ..++.+++||--+|++-.++..|-++|+++.+ ..=||+|||-+..| .+||+-+.+. T Consensus 137 LSGGqkQRvaIARALv----~~P~ill~DEPT~~LD~~~~~~i~~ll~~l~~~g~Tii~vTHd~~~~~~~~drv~~l~ 210 (214) T cd03292 137 LSGGEQQRVAIARAIV----NSPTILIADEPTGNLDPDTTWEIMNLLKKINKAGTTVVVATHAKELVDTTRHRVIALE 210 (214) T ss_pred CCHHHHHHHHHHHHHH----CCCCEEEECCCCCCCCHHHHHHHHHHHHHHHHCCCEEEEECCCHHHHHHHCCEEEEEE T ss_conf 8889999999999997----2999999839878779899999999999998509999998989899998689799995 No 112 >PRK13643 cbiO cobalt transporter ATP-binding subunit; Provisional Probab=98.31 E-value=5.8e-06 Score=58.28 Aligned_cols=73 Identities=25% Similarity=0.285 Sum_probs=59.5 Q ss_pred HCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHC-CCEEEEECHHHH-HHHCCCEEEEEE Q ss_conf 06215799999999984366899769980344688879999999999997305-939998083798-650176179999 Q gi|255764514|r 428 ASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSKK-IQLLAVTHAPQV-AARADRHFLVYK 504 (554) Q Consensus 428 aSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~~-~Qvi~ITH~pqv-Aa~a~~h~~v~K 504 (554) +|||++=|+++|-.++ ..++.+||||-=+|++-.....|-++|+++.+. .-||+|||-.-. |.+||+=++..+ T Consensus 145 LSGGqkqRvaiA~aLa----~~P~vLlLDEPTs~LDp~~~~~i~~ll~~l~~~G~TiI~vtHd~~~v~~~adrvivl~~ 219 (288) T PRK13643 145 LSGGQMRRVAIAGILA----MEPEVLVLDEPTAGLDPKARIEMMQLFESIHQSGQTVVLVTHLMDDVADYADYVYLLEK 219 (288) T ss_pred CCHHHHHHHHHHHHHH----CCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCEEEEECCCHHHHHHHCCEEEEEEC T ss_conf 9999999999999997----49999999588555899999999999999995399999986089999997999999989 No 113 >COG4637 Predicted ATPase [General function prediction only] Probab=98.29 E-value=1.1e-05 Score=56.48 Aligned_cols=44 Identities=30% Similarity=0.533 Sum_probs=40.8 Q ss_pred CCEEEEECCEEEEEEEEECCCCEEEEECCCCCCHHHHHHHHHHHH Q ss_conf 925999422789999887389818998899978889999999871 Q gi|255764514|r 1 MTRLSIYNIVLIESLDIDFSAGLSILSGDTGSGKSILLDALILVT 45 (554) Q Consensus 1 L~~L~i~Nf~~i~~~~i~f~~Gl~vItGetGaGKS~ildAl~~~l 45 (554) |.+|.|+||..+++++++. +++|||+|.||||||+++||++++- T Consensus 3 l~si~vknyRs~r~l~lei-~~~nviIGANGaGKSn~~~~l~~l~ 46 (373) T COG4637 3 LVSIKVKNYRSFRSLDLEI-RRVNVIIGANGAGKSNFYDALRLLA 46 (373) T ss_pred CCHHHHHCCHHHHHCCCCC-CCEEEEECCCCCCHHHHHHHHHHHH T ss_conf 1001031322587525645-6357998478776257999999999 No 114 >cd03291 ABCC_CFTR1 The CFTR subfamily domain 1. The cystic fibrosis transmembrane regulator (CFTR), the product of the gene mutated in patients with cystic fibrosis, has adapted the ABC transporter structural motif to form a tightly regulated anion channel at the apical surface of many epithelia. Use of the term assembly of a functional ion channel implies the coming together of subunits, or at least smaller not-yet functional components of the active whole. In fact, on the basis of current knowledge only the CFTR polypeptide itself is required to form an ATP- and protein kinase A-dependent low-conductance chloride channel of the type present in the apical membrane of many epithelial cells. CFTR displays the typical organization (IM-ABC)2 and carries a characteristic hydrophilic R-domain that separates IM1-ABC1 from IM2-ABC2. Probab=98.29 E-value=6.4e-06 Score=57.97 Aligned_cols=101 Identities=18% Similarity=0.123 Sum_probs=73.1 Q ss_pred HCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHH-HHHHHHHHCCCEEEEECHHHHHHHCCCEEEEEEEE Q ss_conf 06215799999999984366899769980344688879999999-99999730593999808379865017617999962 Q gi|255764514|r 428 ASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIG-YRLKQLSKKIQLLAVTHAPQVAARADRHFLVYKTN 506 (554) Q Consensus 428 aSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~-~~l~~ls~~~Qvi~ITH~pqvAa~a~~h~~v~K~~ 506 (554) +|||++-|+++|=.++ .++|.+||||.=++++-.+...|= ..+..+.++.-+|+|||-......||+=++..+ T Consensus 160 LSGGQkQRlaiARALl----~~p~IliLDEpTS~LD~~tE~~I~~~~l~~~~~~kTvI~ItHrL~~i~~aDrIiVL~~-- 233 (282) T cd03291 160 LSGGQRARISLARAVY----KDADLYLLDSPFGYLDVFTEKEIFESCVCKLMANKTRILVTSKMEHLKKADKILILHE-- 233 (282) T ss_pred CCHHHHHHHHHHHHHH----CCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCEEEEEECCHHHHHHCCEEEEEEC-- T ss_conf 8999999999999984----2899899868776689878999999999998689989999378888986999999989-- Q ss_pred CCCCCCEEEEEEEECCHHH---HHHHHHHHHCCCCCHHH Q ss_conf 1687525899999759889---99999998668800289 Q gi|255764514|r 507 KPDDTQRIETYVAVLTPQE---RREEIARMLAGSHITEE 542 (554) Q Consensus 507 ~~~~~~~~~~~i~~l~~~~---r~~Eiarml~g~~~~~~ 542 (554) | + -+..=+.+| ..-+-|.|+.+..-.+. T Consensus 234 --G---~---Ive~Gth~ELm~~~g~ya~~~~~~~~~~~ 264 (282) T cd03291 234 --G---S---SYFYGTFSELQSLRPDFSSKLMGYDTFDQ 264 (282) T ss_pred --C---E---EEEECCHHHHHHCCCHHHHHHHCCCCCCH T ss_conf --8---8---99974889986349789999853764001 No 115 >TIGR02680 TIGR02680 conserved hypothetical protein TIGR02680; InterPro: IPR013496 Proteins in this entry are encoded within a conserved gene four-gene neighbourhood found sporadically in a phylogenetically broad range of bacteria including: Nocardia farcinica, Symbiobacterium thermophilum, and Streptomyces avermitilis (Actinobacteria), Geobacillus kaustophilus (Firmicutes), Azoarcus sp. EbN1 and Ralstonia solanacearum (Betaproteobacteria). These proteins average over 1400 amino acids in length.. Probab=98.29 E-value=0.00041 Score=46.08 Aligned_cols=44 Identities=27% Similarity=0.510 Sum_probs=38.5 Q ss_pred EEEEECCEEEEEEEEECCCCEEEEECCCCCCHHHHHHHH-HHHHC Q ss_conf 599942278999988738981899889997888999999-98714 Q gi|255764514|r 3 RLSIYNIVLIESLDIDFSAGLSILSGDTGSGKSILLDAL-ILVTG 46 (554) Q Consensus 3 ~L~i~Nf~~i~~~~i~f~~Gl~vItGetGaGKS~ildAl-~~~lG 46 (554) |+=|-||--||+.++.|..|==.+=|.||||||-.|.-+ -|+|= T Consensus 6 RaGl~n~w~YD~qeF~F~dGrLLLRG~NGaGKSK~L~lLLPfLlD 50 (1416) T TIGR02680 6 RAGLVNLWYYDEQEFAFRDGRLLLRGNNGAGKSKVLELLLPFLLD 50 (1416) T ss_pred HHHHHHHHHCCCCCEEECCCEEECCCCCCCCHHHHHHHHHHHHCC T ss_conf 666888541246613533850422678986289999865102116 No 116 >cd03226 ABC_cobalt_CbiO_domain2 Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota. The transition metal cobalt is an essential component of many enzymes and must be transported into cells in appropriate amounts when needed. The CbiMNQO family ABC transport system is involved in cobalt transport in association with the cobalamin (vitamin B12) biosynthetic pathways. Most cobalt (Cbi) transport systems possess a separate CbiN component, the cobalt-binding periplasmic protein, and they are encoded by the conserved gene cluster cbiMNQO. Both the CbiM and CbiQ proteins are integral cytoplasmic membrane proteins, and the CbiO protein has the linker peptide and the Walker A and B motifs commonly found in the ATPase components of the ABC-type transport systems. Probab=98.28 E-value=6.9e-06 Score=57.75 Aligned_cols=72 Identities=26% Similarity=0.439 Sum_probs=59.6 Q ss_pred HCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHH-CCCEEEEECHHH-HHHHCCCEEEEE Q ss_conf 0621579999999998436689976998034468887999999999999730-593999808379-865017617999 Q gi|255764514|r 428 ASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSK-KIQLLAVTHAPQ-VAARADRHFLVY 503 (554) Q Consensus 428 aSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~-~~Qvi~ITH~pq-vAa~a~~h~~v~ 503 (554) +|||++=|+++|..++ ..++.++|||.=+|++-.+...+-++|+++.+ ..=||+|||-+. ++..+|+-+... T Consensus 127 LSGGqkQrv~iA~aL~----~~P~illLDEPt~gLD~~~~~~i~~ll~~l~~~g~tvi~itHdl~~~~~~~dri~vl~ 200 (205) T cd03226 127 LSGGQKQRLAIAAALL----SGKDLLIFDEPTSGLDYKNMERVGELIRELAAQGKAVIVITHDYEFLAKVCDRVLLLA 200 (205) T ss_pred CCHHHHHHHHHHHHHH----CCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCEEEEEECCHHHHHHHCCEEEEEE T ss_conf 8999999999999997----5999999979976589999999999999999799999998039899999799999981 No 117 >PRK10744 phosphate transporter subunit; Provisional Probab=98.28 E-value=6.7e-06 Score=57.85 Aligned_cols=73 Identities=27% Similarity=0.291 Sum_probs=60.8 Q ss_pred HCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCEEEEECHHHHHHHCCCEEEEEE Q ss_conf 06215799999999984366899769980344688879999999999997305939998083798650176179999 Q gi|255764514|r 428 ASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSKKIQLLAVTHAPQVAARADRHFLVYK 504 (554) Q Consensus 428 aSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~~~Qvi~ITH~pqvAa~a~~h~~v~K 504 (554) +|||++-|+++|..++ ..++.+||||.=+|++-.+...|-+.++++.++.-||.|||-...|..-..++.|-. T Consensus 154 LSGGqkQRvaiArAL~----~~P~vLllDEPts~LD~~~~~~i~~ll~~l~~~~Tvi~itHdl~~a~~~~Dri~vm~ 226 (257) T PRK10744 154 LSGGQQQRLCIARGIA----IRPEVLLLDEPCSALDPISTGRIEELITELKQDYTVVIVTHNMQQAARCSDHTAFMY 226 (257) T ss_pred CCHHHHHHHHHHHHHH----CCCCEEEECCCCCCCCHHHHHHHHHHHHHHHHCCEEEEEEECHHHHHHHCCEEEEEE T ss_conf 8988989999987775----199988877885536999999999999999719969999619999998699999997 No 118 >cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth. EF-3 stimulates the binding of the EF-1: GTP: aa-tRNA ternary complex to the ribosomal A site by facilitated release of the deacylated tRNA from the E site. The reaction requires ATP hydrolysis. EF-3 contains two ATP nucleotide binding sequence (NBS) motifs. NBSI is sufficient for the intrinsic ATPase activity. NBSII is essential for the ribosome-stimulated functions. Probab=98.27 E-value=6.9e-06 Score=57.76 Aligned_cols=69 Identities=23% Similarity=0.269 Sum_probs=55.4 Q ss_pred HCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCEEEEECHHHHH-HHCCCEEEE Q ss_conf 062157999999999843668997699803446888799999999999973059399980837986-501761799 Q gi|255764514|r 428 ASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSKKIQLLAVTHAPQVA-ARADRHFLV 502 (554) Q Consensus 428 aSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~~~Qvi~ITH~pqvA-a~a~~h~~v 502 (554) +||||+-|+++|..++ ..++++|+||.-+|++=.+...+-+.|++... -+|+|||-+..+ ..+|+=+.. T Consensus 71 LSgGqkqr~~la~al~----~~p~iliLDEPt~~LD~~~~~~i~~~l~~~~~--tii~vsHd~~~~~~~~drii~l 140 (144) T cd03221 71 LSGGEKMRLALAKLLL----ENPNLLLLDEPTNHLDLESIEALEEALKEYPG--TVILVSHDRYFLDQVATKIIEL 140 (144) T ss_pred CCHHHHHHHHHHHHHC----CCCCEEEEECCCCCCCHHHHHHHHHHHHHCCC--EEEEEECCHHHHHHHCCEEEEE T ss_conf 7999999999999972----59989999577555899999999999997099--9999967989999879999999 No 119 >PRK13633 cobalt transporter ATP-binding subunit; Provisional Probab=98.27 E-value=7.6e-06 Score=57.47 Aligned_cols=73 Identities=26% Similarity=0.361 Sum_probs=61.2 Q ss_pred HCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHH--CCCEEEEECHHHHHHHCCCEEEEEE Q ss_conf 0621579999999998436689976998034468887999999999999730--5939998083798650176179999 Q gi|255764514|r 428 ASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSK--KIQLLAVTHAPQVAARADRHFLVYK 504 (554) Q Consensus 428 aSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~--~~Qvi~ITH~pqvAa~a~~h~~v~K 504 (554) +|||++=|+++|-.++. .++.+||||.=+|++-.....+-+.|++|.+ ..-||+|||-...|+.||+=++..+ T Consensus 146 LSGGqkQRvaiA~aLa~----~P~iLilDEPTs~LDp~~~~~i~~~l~~l~~e~g~Tii~vTHdl~~~~~aDrv~vm~~ 220 (281) T PRK13633 146 LSGGQKQRVAIAGILAM----RPECIIFDEPTAMLDPSGRREVVNTIKELNKKYGITIILITHYMEEAVEADRIIVMDK 220 (281) T ss_pred CCHHHHHHHHHHHHHHC----CCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHCCCEEEEECCCHHHHHCCCEEEEEEC T ss_conf 89859999999999985----9999998187343898999999999999998409899998678899973998999989 No 120 >cd03231 ABC_CcmA_heme_exporter CcmA, the ATP-binding component of the bacterial CcmAB transporter. The CCM family is involved in bacterial cytochrome c biogenesis. Cytochrome c maturation in E. coli requires the ccm operon, which encodes eight membrane proteins (CcmABCDEFGH). CcmE is a periplasmic heme chaperone that binds heme covalently and transfers it onto apocytochrome c in the presence of CcmF, CcmG, and CcmH. The CcmAB proteins represent an ABC transporter and the CcmCD proteins participate in heme transfer to CcmE. Probab=98.26 E-value=9e-06 Score=56.99 Aligned_cols=72 Identities=17% Similarity=0.201 Sum_probs=58.3 Q ss_pred HHCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHH-HCCCEEEEEC-HHHHHHHCCCEEEE Q ss_conf 4062157999999999843668997699803446888799999999999973-0593999808-37986501761799 Q gi|255764514|r 427 LASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLS-KKIQLLAVTH-APQVAARADRHFLV 502 (554) Q Consensus 427 iaSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls-~~~Qvi~ITH-~pqvAa~a~~h~~v 502 (554) -+|||++=|++||..++ .++|.++|||.-+|++-.+...+-+.|+++. +..-+|++|| -..+|..+|.++.. T Consensus 125 ~LSgGqkqRv~lA~al~----~~p~llllDEPt~gLD~~s~~~~~~~l~~~~~~g~~ii~~sH~~~~~~~~~~r~i~l 198 (201) T cd03231 125 QLSAGQQRRVALARLLL----SGRPLWILDEPTTALDKAGVARFAEAMAGHCARGGMVVLTTHQDLGLSEAGARELDL 198 (201) T ss_pred HCCHHHHHHHHHHHHHH----CCCCEEEECCCCCCCCHHHHHHHHHHHHHHHHCCCEEEEEECCHHHHHHHCCCEEEC T ss_conf 47999999999999997----499999980886557999999999999999868999999986714678722969982 No 121 >PRK13632 cbiO cobalt transporter ATP-binding subunit; Provisional Probab=98.26 E-value=7.9e-06 Score=57.36 Aligned_cols=73 Identities=26% Similarity=0.293 Sum_probs=61.2 Q ss_pred HCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHH--CCCEEEEECHHHHHHHCCCEEEEEE Q ss_conf 0621579999999998436689976998034468887999999999999730--5939998083798650176179999 Q gi|255764514|r 428 ASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSK--KIQLLAVTHAPQVAARADRHFLVYK 504 (554) Q Consensus 428 aSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~--~~Qvi~ITH~pqvAa~a~~h~~v~K 504 (554) +|||++=|+++|-.++ ..++.+||||.-+|++-.+...+-+.|+++.+ ..-||+|||-...|+.||+=++..+ T Consensus 144 LSGGqkQRvaiA~aLa----~~P~iliLDEPTs~LD~~~~~~l~~~l~~l~~~~g~TvI~iTHd~~~~~~aDrv~vm~~ 218 (273) T PRK13632 144 LSGGQKQRVAIASVLA----LNPEIIIFDESTSMLDPKGKREIKKIMVDLRKDRKKTLISITHDMDEAILADKVIVFSN 218 (273) T ss_pred CCHHHHHHHHHHHHHH----CCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHCCCEEEEEEECHHHHHCCCEEEEEEC T ss_conf 9999999999999997----19999998077556998999999999999998469899999428889971999999989 No 122 >PRK10575 iron-hydroxamate transporter ATP-binding subunit; Provisional Probab=98.26 E-value=1.1e-05 Score=56.37 Aligned_cols=73 Identities=25% Similarity=0.271 Sum_probs=59.3 Q ss_pred HCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHC--CCEEEEECHHHH-HHHCCCEEEEEE Q ss_conf 06215799999999984366899769980344688879999999999997305--939998083798-650176179999 Q gi|255764514|r 428 ASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSKK--IQLLAVTHAPQV-AARADRHFLVYK 504 (554) Q Consensus 428 aSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~~--~Qvi~ITH~pqv-Aa~a~~h~~v~K 504 (554) +||||+=|+++|..++ ..++.+|+||.-+|++-.+...+-+.|+++.+. .=||+|||-... +.+||+=++..+ T Consensus 148 LSGGq~QRv~iAraL~----~~P~lLlLDEPts~LD~~~~~~i~~~l~~l~~~~g~tvi~vtHdl~~~~~~aDrv~vl~~ 223 (265) T PRK10575 148 LSGGERQRAWIAMLVA----QDSRCLLLDEPTSALDIAHQVDVLALVHRLSQERGLTVIAVLHDINMAARYCDYLVALRG 223 (265) T ss_pred CCHHHHHHHHHHHHHH----CCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCCEEEEEECCHHHHHHHCCEEEEEEC T ss_conf 8999999999999875----699989981776558999999999999999862898999993888999996999999989 No 123 >cd03263 ABC_subfamily_A The ABCA subfamily mediates the transport of a variety of lipid compounds. Mutations of members of ABCA subfamily are associated with human genetic diseases, such as, familial high-density lipoprotein (HDL) deficiency, neonatal surfactant deficiency, degenerative retinopathies, and congenital keratinization disorders. The ABCA1 protein is involved in disorders of cholesterol transport and high-density lipoprotein (HDL) biosynthesis. The ABCA4 (ABCR) protein transports vitamin A derivatives in the outer segments of photoreceptor cells, and therefore, performs a crucial step in the visual cycle. The ABCA genes are not present in yeast. However, evolutionary studies of ABCA genes indicate that they arose as transporters that subsequently duplicated and that certain sets of ABCA genes were lost in different eukaryotic lineages. Probab=98.24 E-value=1.1e-05 Score=56.47 Aligned_cols=73 Identities=29% Similarity=0.357 Sum_probs=61.9 Q ss_pred HHCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCEEEEECHHHHH-HHCCCEEEEE Q ss_conf 4062157999999999843668997699803446888799999999999973059399980837986-5017617999 Q gi|255764514|r 427 LASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSKKIQLLAVTHAPQVA-ARADRHFLVY 503 (554) Q Consensus 427 iaSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~~~Qvi~ITH~pqvA-a~a~~h~~v~ 503 (554) -+|||++-|+++|..++ ..++.+|+||.=+|++-.+...+-++|+++.+..=||++||....| ..+|+-+.+. T Consensus 133 ~LSgG~kqrv~ia~al~----~~P~lliLDEPt~gLD~~~~~~i~~~l~~~~~~~tii~~tH~l~e~~~l~dri~vl~ 206 (220) T cd03263 133 TLSGGMKRKLSLAIALI----GGPSVLLLDEPTSGLDPASRRAIWDLILEVRKGRSIILTTHSMDEAEALCDRIAIMS 206 (220) T ss_pred HCCHHHHHHHHHHHHHH----CCCCEEEEECCCCCCCHHHHHHHHHHHHHHHCCCEEEEECCCHHHHHHHCCEEEEEE T ss_conf 78999999999999995----699999995887688999999999999998489989999687899999699999998 No 124 >PRK13635 cbiO cobalt transporter ATP-binding subunit; Provisional Probab=98.24 E-value=8.6e-06 Score=57.12 Aligned_cols=73 Identities=29% Similarity=0.357 Sum_probs=61.8 Q ss_pred HCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCC--CEEEEECHHHHHHHCCCEEEEEE Q ss_conf 062157999999999843668997699803446888799999999999973059--39998083798650176179999 Q gi|255764514|r 428 ASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSKKI--QLLAVTHAPQVAARADRHFLVYK 504 (554) Q Consensus 428 aSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~~~--Qvi~ITH~pqvAa~a~~h~~v~K 504 (554) +|||++=|+++|-.++. .++.+||||.=+|++-.+...|-+.|++|.+.. -||+|||--..|+.||+=++..+ T Consensus 141 LSGGQrQRvaIAraL~~----~P~iLilDEPTs~LD~~~~~~i~~~l~~L~~~~g~TvI~itHdl~~~~~aDRiivm~~ 215 (279) T PRK13635 141 LSGGQKQRVAIAGVLAL----QPDILILDEATSMLDPQGRREVLETVRQLKEQKGITVLSITHDLDEAAQADRVIVMNK 215 (279) T ss_pred CCHHHHHHHHHHHHHHC----CCCEEEECCCCCCCCHHHHHHHHHHHHHHHHCCCCEEEEEEECHHHHHCCCEEEEEEC T ss_conf 99999999999999970----9998997387454898999999999999998379899999767899963998999989 No 125 >cd03215 ABC_Carb_Monos_II This family represents domain II of the carbohydrate uptake proteins that transport only monosaccharides (Monos). The Carb_Monos family is involved in the uptake of monosaccharides, such as pentoses (such as xylose, arabinose, and ribose) and hexoses (such as xylose, arabinose, and ribose), that cannot be broken down to simple sugars by hydrolysis. In members of Carb_Monos family the single hydrophobic gene product forms a homodimer, while the ABC protein represents a fusion of two nucleotide-binding domains. However, it is assumed that two copies of the ABC domains are present in the assembled transporter. Probab=98.23 E-value=1.1e-05 Score=56.36 Aligned_cols=72 Identities=21% Similarity=0.346 Sum_probs=59.0 Q ss_pred HCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHC-CCEEEEEC-HHHHHHHCCCEEEEE Q ss_conf 06215799999999984366899769980344688879999999999997305-93999808-379865017617999 Q gi|255764514|r 428 ASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSKK-IQLLAVTH-APQVAARADRHFLVY 503 (554) Q Consensus 428 aSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~~-~Qvi~ITH-~pqvAa~a~~h~~v~ 503 (554) +|||++-|++||..++ ..++.+|+||.=+|++-.+...+-+.|+++.+. .=||.||| ++.+...+|+=+.+. T Consensus 105 LSGG~~Qrv~lAral~----~~p~llllDEPT~gLD~~~~~~i~~~i~~l~~~g~tvi~isHdl~~~~~~~Drv~vl~ 178 (182) T cd03215 105 LSGGNQQKVVLARWLA----RDPRVLILDEPTRGVDVGAKAEIYRLIRELADAGKAVLLISSELDELLGLCDRILVMY 178 (182) T ss_pred CCHHHHHHHHHHHHHH----CCCCEEEECCCCCCCCHHHHHHHHHHHHHHHHCCCEEEEEECCHHHHHHHCCEEEEEC T ss_conf 9989999999999997----1999999868754589999999999999999789999999687999999799999983 No 126 >COG3910 Predicted ATPase [General function prediction only] Probab=98.23 E-value=4.6e-07 Score=65.52 Aligned_cols=40 Identities=33% Similarity=0.581 Sum_probs=33.2 Q ss_pred CCEEEEEE--EEECCCCEEEEECCCCCCHHHHHHHHHHHHCC Q ss_conf 22789999--88738981899889997888999999987147 Q gi|255764514|r 8 NIVLIESL--DIDFSAGLSILSGDTGSGKSILLDALILVTGG 47 (554) Q Consensus 8 Nf~~i~~~--~i~f~~Gl~vItGetGaGKS~ildAl~~~lG~ 47 (554) |...++.+ .++|.+-+|+||||||+|||+||+||...+|- T Consensus 22 slPa~r~l~~~LeF~apIT~i~GENGsGKSTLLEaiA~~~~~ 63 (233) T COG3910 22 SLPAFRHLEERLEFRAPITFITGENGSGKSTLLEAIAAGMGF 63 (233) T ss_pred CCHHHHHHHHHCCCCCCEEEEECCCCCCHHHHHHHHHHHCCC T ss_conf 356777554422346864899768986578899999965651 No 127 >PRK10771 thiQ thiamine transporter ATP-binding subunit; Provisional Probab=98.23 E-value=1e-05 Score=56.59 Aligned_cols=73 Identities=30% Similarity=0.363 Sum_probs=60.5 Q ss_pred HCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCC--CEEEEECHHH-HHHHCCCEEEEEE Q ss_conf 062157999999999843668997699803446888799999999999973059--3999808379-8650176179999 Q gi|255764514|r 428 ASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSKKI--QLLAVTHAPQ-VAARADRHFLVYK 504 (554) Q Consensus 428 aSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~~~--Qvi~ITH~pq-vAa~a~~h~~v~K 504 (554) +|||++-|+++|-.++ ..++.++|||.-+|++-.+...+-++|+++.+.. =||+|||-.. ++..+|+=+++.+ T Consensus 130 LSGGq~QRv~iAraL~----~~P~vLllDEPts~LD~~~~~~i~~ll~~l~~~~~~til~vtHdl~~~~~~adri~vl~~ 205 (233) T PRK10771 130 LSGGQRQRVALARCLV----REQPILLLDEPFSALDPALRQEMLTLVSQVCQQRQLTLLMVSHSVEDAARIAPRSLVVAD 205 (233) T ss_pred CCHHHHHHHHHHHHHH----CCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHCCCEEEEEECCHHHHHHHCCEEEEEEC T ss_conf 9999999999999985----599999992877557999999999999999983698999992489999996999999989 No 128 >CHL00131 ycf16 sulfate ABC transporter protein; Validated Probab=98.23 E-value=1.2e-05 Score=56.20 Aligned_cols=73 Identities=22% Similarity=0.266 Sum_probs=57.4 Q ss_pred HCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHH-CCCEEEEECHHHHHHH-CCCEEEEEE Q ss_conf 0621579999999998436689976998034468887999999999999730-5939998083798650-176179999 Q gi|255764514|r 428 ASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSK-KIQLLAVTHAPQVAAR-ADRHFLVYK 504 (554) Q Consensus 428 aSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~-~~Qvi~ITH~pqvAa~-a~~h~~v~K 504 (554) +||||+=|+++|-.++. .++.+||||.-+|++-.+...+-+.|+++.+ ..=+|+|||-+.++++ +..++.|-+ T Consensus 151 LSGGqkqRv~iaral~~----~P~iLiLDEPTsgLD~~~~~~i~~~l~~l~~~g~tii~itH~~~~~~~~~aDri~vm~ 225 (252) T CHL00131 151 FSGGEKKRNEILQMALL----DSKLAILDETDSGLDIDALKIIAEGINKLATSDNAIILITHYQRLLDYIKPDYVHVMQ 225 (252) T ss_pred CCHHHHHHHHHHHHHHH----CCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCEEEEEEECHHHHHHHCCCEEEEEE T ss_conf 78999999999999963----9999999798766999999999999999985899999999866989877399999987 No 129 >PRK13646 cbiO cobalt transporter ATP-binding subunit; Provisional Probab=98.23 E-value=1e-05 Score=56.66 Aligned_cols=73 Identities=21% Similarity=0.315 Sum_probs=61.5 Q ss_pred HCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHH--HCCCEEEEECHHH-HHHHCCCEEEEEE Q ss_conf 062157999999999843668997699803446888799999999999973--0593999808379-8650176179999 Q gi|255764514|r 428 ASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLS--KKIQLLAVTHAPQ-VAARADRHFLVYK 504 (554) Q Consensus 428 aSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls--~~~Qvi~ITH~pq-vAa~a~~h~~v~K 504 (554) +|||++=|+++|-.++ ..++.+||||.=+|++-.....|.++|++|. ...-||+|||--. ||.+||+=++..+ T Consensus 146 LSGGqkqRVaiA~aLa----~~P~iLilDEPTagLDp~~~~~i~~ll~~l~~~~g~TiI~iTHdm~~v~~~adrv~vm~~ 221 (286) T PRK13646 146 MSGGQMRKIAIVSILA----MNPDIIVVDEPTAGLDPQSKRQVMRLLKSLQTDENKAIILISHDMNEVARYADEVIVMKE 221 (286) T ss_pred CCHHHHHHHHHHHHHH----CCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHCCCEEEEECCCHHHHHHHCCEEEEEEC T ss_conf 9999999999999985----198999983874438989999999999999995398999991389999996999999989 No 130 >PRK11231 fecE iron-dicitrate transporter ATP-binding subunit; Provisional Probab=98.22 E-value=3e-06 Score=60.17 Aligned_cols=73 Identities=19% Similarity=0.281 Sum_probs=59.5 Q ss_pred HCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHC-CCEEEEECHHHHHH-HCCCEEEEEE Q ss_conf 06215799999999984366899769980344688879999999999997305-93999808379865-0176179999 Q gi|255764514|r 428 ASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSKK-IQLLAVTHAPQVAA-RADRHFLVYK 504 (554) Q Consensus 428 aSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~~-~Qvi~ITH~pqvAa-~a~~h~~v~K 504 (554) +||||+=|+++|-.++ ..++.++|||.-+|++-.....+-+.|+++.+. .=||+|||-...|+ ++|+-++..+ T Consensus 139 LSGGqkQRv~iAraL~----~~p~lllLDEPtsgLD~~~~~~i~~li~~l~~~g~tvi~vtHdl~~~~~~aDriivl~~ 213 (255) T PRK11231 139 LSGGQRQRAFLAMVLA----QDTPVVLLDEPTTYLDINHQVELMRLMRELNTQGKTVVTVLHDLNQASRYCDHLVVMAN 213 (255) T ss_pred CCHHHHHHHHHHHHHH----CCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCEEEEEECCHHHHHHHCCEEEEEEC T ss_conf 9999999999999995----39997998388644899999999999999986899999993788999996999999989 No 131 >PRK13544 consensus Probab=98.22 E-value=1.3e-05 Score=56.00 Aligned_cols=76 Identities=13% Similarity=0.035 Sum_probs=64.5 Q ss_pred HCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHH-CCCEEEEECHHHHHHHCCCEEEEEEEE Q ss_conf 0621579999999998436689976998034468887999999999999730-593999808379865017617999962 Q gi|255764514|r 428 ASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSK-KIQLLAVTHAPQVAARADRHFLVYKTN 506 (554) Q Consensus 428 aSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~-~~Qvi~ITH~pqvAa~a~~h~~v~K~~ 506 (554) +|||++=|++||..++ .+++.++|||.-+|++-.+...+-++|+++.+ ..=||++||-+.-|-.......+.|-. T Consensus 127 LSgG~kqrv~la~aL~----~~~~illLDEPt~gLD~~s~~~i~~~i~~~~~~g~~vIi~sHd~~e~~~~cd~i~l~~~~ 202 (208) T PRK13544 127 LSSGWKRRVALSRLLI----YNTNVWIIDEPFANLDSATKELILELILTRLEQNGIVIISDHSKTETYGECQVINLEPFN 202 (208) T ss_pred CCHHHHHHHHHHHHHH----CCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCEEEEECCCHHHHHHHCCEEEECCCC T ss_conf 7999999999999985----699999997986668999999999999999868999999869999999768999803489 Q ss_pred C Q ss_conf 1 Q gi|255764514|r 507 K 507 (554) Q Consensus 507 ~ 507 (554) . T Consensus 203 ~ 203 (208) T PRK13544 203 N 203 (208) T ss_pred C T ss_conf 9 No 132 >PRK10908 cell division protein FtsE; Provisional Probab=98.22 E-value=1.6e-05 Score=55.42 Aligned_cols=74 Identities=23% Similarity=0.341 Sum_probs=60.5 Q ss_pred HCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHH-CCCEEEEECHHHHHHHCCCEEEEEEE Q ss_conf 0621579999999998436689976998034468887999999999999730-59399980837986501761799996 Q gi|255764514|r 428 ASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSK-KIQLLAVTHAPQVAARADRHFLVYKT 505 (554) Q Consensus 428 aSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~-~~Qvi~ITH~pqvAa~a~~h~~v~K~ 505 (554) +||||+=|+++|-.++ ..++.+++||.-+|++-.+...|-+.|+++.+ ..-||+|||-...|+.-..++.|-+. T Consensus 138 LSGGq~QRvaiAraL~----~~P~iLllDEPt~~LD~~~~~~v~~~l~~l~~~g~tvl~vtHd~~~~~~~~dri~vl~~ 212 (222) T PRK10908 138 LSGGEQQRVGIARAVV----NKPAVLLADEPTGNLDDALSEGILRLFEEFNRVGVTVLMATHDIGLISRRSYRMLTLSD 212 (222) T ss_pred CCHHHHHHHHHHHHHH----CCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCEEEEECCCHHHHHHHCCEEEEEEC T ss_conf 8968999999999997----69999999098766799999999999999986199999994799999986999999979 No 133 >TIGR00955 3a01204 Pigment precourser permease; InterPro: IPR005284 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems. ABC transporters are minimally constituted of two conserved regions: a highly conserved ATP binding cassette (ABC) and a less conserved transmembrane domain (TMD). These regions can be found on the same protein or on two different ones. Most ABC transporters function as a dimer and therefore are constituted of four domains, two ABC modules and two TMDs. ABC transporters are involved in the export or import of a wide variety of substrates ranging from small ions to macromolecules. The major function of ABC import systems is to provide essential nutrients to bacteria. They are found only in prokaryotes and their four constitutive domains are usually encoded by independent polypeptides (two ABC proteins and two TMD proteins). Prokaryotic importers require additional extracytoplasmic binding proteins (one or more per systems) for function. In contrast, export systems are involved in the extrusion of noxious substances, the export of extracellular toxins and the targeting of membrane components. They are found in all living organisms and in general the TMD is fused to the ABC module in a variety of combinations. Some eukaryotic exporters encode the four domains on the same polypeptide chain . The ABC module (approximately two hundred amino acid residues) is known to bind and hydrolyze ATP, thereby coupling transport to ATP hydrolysis in a large number of biological processes. The cassette is duplicated in several subfamilies. Its primary sequence is highly conserved, displaying a typical phosphate-binding loop: Walker A, and a magnesium binding site: Walker B. Besides these two regions, three other conserved motifs are present in the ABC cassette: the switch region which contains a histidine loop, postulated to polarize the attaching water molecule for hydrolysis, the signature conserved motif (LSGGQ) specific to the ABC transporter, and the Q-motif (between Walker A and the signature), which interacts with the gamma phosphate through a water bond. The Walker A, Walker B, Q-loop and switch region form the nucleotide binding site , , . The 3D structure of a monomeric ABC module adopts a stubby L-shape with two distinct arms. ArmI (mainly beta-strand) contains Walker A and Walker B. The important residues for ATP hydrolysis and/or binding are located in the P-loop. The ATP-binding pocket is located at the extremity of armI. The perpendicular armII contains mostly the alpha helical subdomain with the signature motif. It only seems to be required for structural integrity of the ABC module. ArmII is in direct contact with the TMD. The hinge between armI and armII contains both the histidine loop and the Q-loop, making contact with the gamma phosphate of the ATP molecule. ATP hydrolysis leads to a conformational change that could facilitate ADP release. In the dimer the two ABC cassettes contact each other through hydrophobic interactions at the antiparallel beta-sheet of armI by a two-fold axis , , , , , . Proteins known to belong to this family are classified in several functional subfamilies depending on the substrate used (for further information see http://www.tcdb.org/tcdb/index.php?tc=3.A.1). This family includes different parts of a membrane-spanning permease system necessary for the transport of pigment precursor into pigment cells responsible for eye color. White protein dimerises with brown protein for the transport of guanine and with scarlet protein for the transport of tryptophan.; GO: 0006810 transport. Probab=98.22 E-value=3e-06 Score=60.12 Aligned_cols=24 Identities=38% Similarity=0.678 Sum_probs=12.6 Q ss_pred CCCC-EEEEECCCCCCHHHHHHHHH Q ss_conf 3898-18998899978889999999 Q gi|255764514|r 19 FSAG-LSILSGDTGSGKSILLDALI 42 (554) Q Consensus 19 f~~G-l~vItGetGaGKS~ildAl~ 42 (554) +.|| |-+|=|.+|||||+||+||. T Consensus 55 a~~GeLlA~mGsSGAGKTTLmn~La 79 (671) T TIGR00955 55 AKPGELLAIMGSSGAGKTTLMNALA 79 (671) T ss_pred ECCCEEEEEECCCCCCHHHHHHHHH T ss_conf 1067068984787662689999985 No 134 >PRK10938 putative molybdenum transport ATP-binding protein ModF; Provisional Probab=98.22 E-value=1.3e-05 Score=55.91 Aligned_cols=79 Identities=20% Similarity=0.169 Sum_probs=61.5 Q ss_pred CHHHHHHCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCC--CEEEEECHHHHHH-HCCC Q ss_conf 113544062157999999999843668997699803446888799999999999973059--3999808379865-0176 Q gi|255764514|r 422 GPLMKLASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSKKI--QLLAVTHAPQVAA-RADR 498 (554) Q Consensus 422 ~pl~kiaSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~~~--Qvi~ITH~pqvAa-~a~~ 498 (554) +|+. .+||||+-|++||-.++ ..++++|+||.=+|++-.+-..|.++|++|.... -+|+|||-+..+. ++.+ T Consensus 397 ~p~~-~LSGGqqqrv~lAr~L~----~~P~vLiLDEPT~gLD~~~~~~i~~ll~~l~~~g~~~il~vSHd~e~~~~~~~~ 471 (490) T PRK10938 397 APFH-SLSWGQQRLALIVRALV----KHPTLLILDEPLQGLDPLNRQLVRRFVDVLISEGETQLLFVSHHAEDAPACITH 471 (490) T ss_pred CCCC-CCCHHHHHHHHHHHHHH----HCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCCEEEEECCCHHHHHHHCCC T ss_conf 9523-19999999999999997----199989996875476999999999999999977992999974899999985599 Q ss_pred EEEEEEE Q ss_conf 1799996 Q gi|255764514|r 499 HFLVYKT 505 (554) Q Consensus 499 h~~v~K~ 505 (554) -+.|... T Consensus 472 r~~~~~d 478 (490) T PRK10938 472 RLEFVPD 478 (490) T ss_pred EEEEEEC T ss_conf 9999869 No 135 >PRK13652 cbiO cobalt transporter ATP-binding subunit; Provisional Probab=98.21 E-value=1.1e-05 Score=56.44 Aligned_cols=73 Identities=27% Similarity=0.307 Sum_probs=61.3 Q ss_pred HCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHC--CCEEEEECHHH-HHHHCCCEEEEEE Q ss_conf 06215799999999984366899769980344688879999999999997305--93999808379-8650176179999 Q gi|255764514|r 428 ASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSKK--IQLLAVTHAPQ-VAARADRHFLVYK 504 (554) Q Consensus 428 aSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~~--~Qvi~ITH~pq-vAa~a~~h~~v~K 504 (554) +|||++-|+++|-.++ ..++.+||||.=+|++-.+...+-+.|+++.+. .-||+|||--. |+.+||+=++..+ T Consensus 138 LSGGqkqRvaiA~aL~----~~P~lLlLDEPtagLDp~~~~~i~~~l~~l~~~~g~Tii~vtHdl~~v~~~aDri~vl~~ 213 (277) T PRK13652 138 LSGGEKKRVAIAGILA----MEPQVLVLDEPTAGLDPQGVKELFDFLNALPETYGMTVIFSTHQVELVAEMADYIYVMEK 213 (277) T ss_pred CCHHHHHHHHHHHHHH----HCCCEEEECCCCCCCCHHHHHHHHHHHHHHHHHCCCEEEEECCCHHHHHHHCCEEEEEEC T ss_conf 8999999999999998----299999983974548999999999999999985098999991489999997999999989 No 136 >PRK13644 cbiO cobalt transporter ATP-binding subunit; Provisional Probab=98.21 E-value=1.3e-05 Score=55.99 Aligned_cols=73 Identities=27% Similarity=0.278 Sum_probs=60.9 Q ss_pred HCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHH-CCCEEEEECHHHHHHHCCCEEEEEE Q ss_conf 0621579999999998436689976998034468887999999999999730-5939998083798650176179999 Q gi|255764514|r 428 ASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSK-KIQLLAVTHAPQVAARADRHFLVYK 504 (554) Q Consensus 428 aSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~-~~Qvi~ITH~pqvAa~a~~h~~v~K 504 (554) +|||++=|+++|-.++ ..++.+||||.-+|++-.+...+-+.+++|.+ ..=||+|||--..+..||+=++..+ T Consensus 137 LSGGqkQRvaiA~aLa----~~P~iLiLDEPTs~LD~~~~~~i~~~l~~L~~~g~TvI~itHdl~~~~~aDrvivl~~ 210 (274) T PRK13644 137 LSGGQGQCVALAGILT----MEPECLIFDEVTSMLDPDSGIAVLERIKKLHEKGKTIVYITHNLEELHDADRIIVMDR 210 (274) T ss_pred CCHHHHHHHHHHHHHH----HCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCEEEEEEECHHHHHCCCEEEEEEC T ss_conf 9976999999999998----2999999979866789999999999999998689999998337899971998999989 No 137 >cd03237 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 of RNase L inhibitor. The ABC ATPase, RNase L inhibitor (RLI), is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids. RLI's are not transport proteins and thus cluster with a group of soluble proteins that lack the transmembrane components commonly found in other members of the family. Structurally, RLI's have an N-terminal Fe-S domain and two nucleotide-binding domains which are arranged to form two composite active sites in their interface cleft. RLI is one of the most conserved enzymes between archaea and eukaryotes with a sequence identity of more than 48%. The high degree of evolutionary conservation suggests that RLI performs a central role in archaeal and eukaryotic physiology. Probab=98.20 E-value=1.4e-05 Score=55.80 Aligned_cols=72 Identities=17% Similarity=0.222 Sum_probs=59.8 Q ss_pred HCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCC--CEEEEECHHHHHHHCCCEEEEE Q ss_conf 062157999999999843668997699803446888799999999999973059--3999808379865017617999 Q gi|255764514|r 428 ASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSKKI--QLLAVTHAPQVAARADRHFLVY 503 (554) Q Consensus 428 aSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~~~--Qvi~ITH~pqvAa~a~~h~~v~ 503 (554) +||||+=|+++|..++ ..++.++|||.=+|++-.....+-+.|+++.+.. =||+|||-...|+.=-.++.|- T Consensus 116 LSGGqkQRv~iA~aL~----~~p~ilLLDEPts~LD~~~~~~i~~~i~~l~~~~~~Tvi~VtHDl~~a~~~aDrIivl 189 (246) T cd03237 116 LSGGELQRVAIAACLS----KDADIYLLDEPSAYLDVEQRLMASKVIRRFAENNEKTAFVVEHDIIMIDYLADRLIVF 189 (246) T ss_pred CCHHHHHHHHHHHHHH----CCCCEEEECCCCCCCCHHHHHHHHHHHHHHHHHCCCEEEEECCCHHHHHHHCCEEEEE T ss_conf 8985999999999984----1999999848987689999999999999999867989999837899999869999998 No 138 >PRK13641 cbiO cobalt transporter ATP-binding subunit; Provisional Probab=98.20 E-value=1.4e-05 Score=55.74 Aligned_cols=73 Identities=25% Similarity=0.291 Sum_probs=60.2 Q ss_pred HCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHC-CCEEEEECH-HHHHHHCCCEEEEEE Q ss_conf 06215799999999984366899769980344688879999999999997305-939998083-798650176179999 Q gi|255764514|r 428 ASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSKK-IQLLAVTHA-PQVAARADRHFLVYK 504 (554) Q Consensus 428 aSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~~-~Qvi~ITH~-pqvAa~a~~h~~v~K 504 (554) +|||++=|+++|-.++ ..++.++|||.=+|++-.....+-+.|+++.+. .=||.|||- ..||.+||+=++..+ T Consensus 146 LSGGqkqRvaiA~aLa----~~P~iLlLDEPTsgLDp~~~~~i~~ll~~l~~~G~Tii~vtHd~~~v~~~adrv~vm~~ 220 (286) T PRK13641 146 LSGGQMRRVAIAGVMA----YEPEILCLDEPAAGLDPEGRKEMMQIFKDYQKAGHTVILVTHNMDDVAEYADDVLVLEH 220 (286) T ss_pred CCHHHHHHHHHHHHHH----CCCCEEEECCCCCCCCHHHHHHHHHHHHHHHHCCCEEEEECCCHHHHHHHCCEEEEEEC T ss_conf 9999999999999997----49999997397343899999999999999996399999991599999997999999989 No 139 >PRK10522 multidrug transporter membrane component/ATP-binding component; Provisional Probab=98.20 E-value=1.4e-05 Score=55.78 Aligned_cols=73 Identities=21% Similarity=0.220 Sum_probs=62.5 Q ss_pred HCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHC--CCEEEEECHHHHHHHCCCEEEEEE Q ss_conf 06215799999999984366899769980344688879999999999997305--939998083798650176179999 Q gi|255764514|r 428 ASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSKK--IQLLAVTHAPQVAARADRHFLVYK 504 (554) Q Consensus 428 aSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~~--~Qvi~ITH~pqvAa~a~~h~~v~K 504 (554) +||||+=|+++|=.++ .++|.+||||-=++++.++...+-+.+.++.++ +=+|+|||-+.....||+=+++.+ T Consensus 450 LSGGQrQRiaIARAll----~~p~ILILDEaTSaLD~~te~~i~~~l~~~~~~~grT~IvIaHRLsti~~aD~IiVl~~ 524 (547) T PRK10522 450 LSKGQKKRLALLLALA----EERDILLLDEWAADQDPHFRREFYQVLLPLLQEMGKTIFAISHDDHYFIHADRLLEMRN 524 (547) T ss_pred CCHHHHHHHHHHHHHH----CCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHCCCEEEEEECCHHHHHHCCEEEEEEC T ss_conf 2999999999999997----49999999685557899999999999999987069899998248899981998999989 No 140 >cd03256 ABC_PhnC_transporter ABC-type phosphate/phosphonate transport system. Phosphonates are a class of organophosphorus compounds characterized by a chemically stable carbon-to-phosphorus (C-P) bond. Phosphonates are widespread among naturally occurring compounds in all kingdoms of wildlife, but only procaryotic microorganisms are able to cleave this bond. Certain bacteria such as E. coli can use alkylphosphonates as a phosphorus source. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins. Probab=98.20 E-value=1.7e-05 Score=55.13 Aligned_cols=72 Identities=22% Similarity=0.266 Sum_probs=60.3 Q ss_pred HCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHH--CCCEEEEECHHHHHH-HCCCEEEEE Q ss_conf 0621579999999998436689976998034468887999999999999730--593999808379865-017617999 Q gi|255764514|r 428 ASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSK--KIQLLAVTHAPQVAA-RADRHFLVY 503 (554) Q Consensus 428 aSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~--~~Qvi~ITH~pqvAa-~a~~h~~v~ 503 (554) +||||+=|+++|-.++ ..++.+++||.=+|++-.++..|-+.|+++.+ ..=||+|||-+.+|+ +||+=+... T Consensus 145 LSGGq~QRVaIARAL~----~~P~ill~DEPts~LD~~~~~~i~~ll~~l~~~~g~Tii~vtHdl~~a~~~adri~~l~ 219 (241) T cd03256 145 LSGGQQQRVAIARALM----QQPKLILADEPVASLDPASSRQVMDLLKRINREEGITVIVSLHQVDLAREYADRIVGLK 219 (241) T ss_pred CCHHHHHHHHHHHHHH----CCCCEEEECCCCCCCCHHHHHHHHHHHHHHHHHCCCEEEEECCCHHHHHHHCCEEEEEE T ss_conf 4802899999999985----59998996287665899999999999999998519899999579899999699899996 No 141 >COG0396 sufC Cysteine desulfurase activator ATPase [Posttranslational modification, protein turnover, chaperones] Probab=98.19 E-value=1.4e-05 Score=55.75 Aligned_cols=66 Identities=23% Similarity=0.284 Sum_probs=53.4 Q ss_pred HCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHH-CCCEEEEECHHHHHHHCC Q ss_conf 0621579999999998436689976998034468887999999999999730-593999808379865017 Q gi|255764514|r 428 ASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSK-KIQLLAVTHAPQVAARAD 497 (554) Q Consensus 428 aSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~-~~Qvi~ITH~pqvAa~a~ 497 (554) .||||+-|.=++=..++ .| .++|+||+|+|++=.....|++-+..+-. ..=+++|||-+.++.+-. T Consensus 145 FSGGEkKR~EilQ~~~l---eP-kl~ILDE~DSGLDIdalk~V~~~i~~lr~~~~~~liITHy~rll~~i~ 211 (251) T COG0396 145 FSGGEKKRNEILQLLLL---EP-KLAILDEPDSGLDIDALKIVAEGINALREEGRGVLIITHYQRLLDYIK 211 (251) T ss_pred CCCCHHHHHHHHHHHHC---CC-CEEEECCCCCCCCHHHHHHHHHHHHHHHCCCCEEEEEECHHHHHHHCC T ss_conf 47315779999999845---99-889955887675589999999999998658972999955799984268 No 142 >PRK13409 putative ATPase RIL; Provisional Probab=98.19 E-value=7.2e-06 Score=57.63 Aligned_cols=77 Identities=18% Similarity=0.251 Sum_probs=63.1 Q ss_pred HHHHHHCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHH--CCCEEEEECHHHHHHHCCCEE Q ss_conf 135440621579999999998436689976998034468887999999999999730--593999808379865017617 Q gi|255764514|r 423 PLMKLASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSK--KIQLLAVTHAPQVAARADRHF 500 (554) Q Consensus 423 pl~kiaSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~--~~Qvi~ITH~pqvAa~a~~h~ 500 (554) |+. .+||||+.|++||..++ .++..|||||-=++++=+.-..+++.|+.+.. ..=+|||+|==..+-+=.... T Consensus 450 ~v~-~LSGGEkQRvaLA~~L~----~~anvLLLDEPTn~LDvE~R~~~~k~i~~~~~~~~~t~~vV~HD~~~~d~lsdrv 524 (590) T PRK13409 450 NVK-DLSGGELQRVAIAACLS----RDADLYLLDEPSAYLDVEQRLAVARAIRRIAEEKEKAALVVDHDIYMIDYISDRL 524 (590) T ss_pred CHH-HCCHHHHHHHHHHHHHC----CCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHCCCEEEEEECCHHHHHHHCCEE T ss_conf 624-40989999999999866----7999999948988778899999999999999866975999947099998761669 Q ss_pred EEEE Q ss_conf 9999 Q gi|255764514|r 501 LVYK 504 (554) Q Consensus 501 ~v~K 504 (554) .|.. T Consensus 525 ~vf~ 528 (590) T PRK13409 525 MVFE 528 (590) T ss_pred EEEC T ss_conf 9981 No 143 >PRK13645 cbiO cobalt transporter ATP-binding subunit; Provisional Probab=98.18 E-value=1.8e-05 Score=55.04 Aligned_cols=73 Identities=27% Similarity=0.294 Sum_probs=59.7 Q ss_pred HCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHC--CCEEEEECHHHHH-HHCCCEEEEEE Q ss_conf 06215799999999984366899769980344688879999999999997305--9399980837986-50176179999 Q gi|255764514|r 428 ASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSKK--IQLLAVTHAPQVA-ARADRHFLVYK 504 (554) Q Consensus 428 aSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~~--~Qvi~ITH~pqvA-a~a~~h~~v~K 504 (554) +|||++=|+++|-.++ ..++.+||||.=||++-.....+-++|++|.+. .=||+|||-...| ..||+=++... T Consensus 151 LSGGqkqRVaiA~aLa----~~P~iLilDEPTagLDp~~~~~i~~ll~~L~~~~g~Tvi~vtHdm~~v~~~aDrviVm~~ 226 (289) T PRK13645 151 LSGGQKRRVALAGIIA----MDGNTLVLDEPTGGLDPKGEEDFINLFERLNKEYKKRIIMVTHNMDQVLRIADEVIVMHE 226 (289) T ss_pred CCHHHHHHHHHHHHHH----CCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHCCCEEEEECCCHHHHHHHCCEEEEEEC T ss_conf 9999999999999996----399999995887648989999999999999995699999991599999997999999989 No 144 >PRK13634 cbiO cobalt transporter ATP-binding subunit; Provisional Probab=98.18 E-value=1.5e-05 Score=55.52 Aligned_cols=73 Identities=27% Similarity=0.310 Sum_probs=59.5 Q ss_pred HCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHH--CCCEEEEECHHH-HHHHCCCEEEEEE Q ss_conf 0621579999999998436689976998034468887999999999999730--593999808379-8650176179999 Q gi|255764514|r 428 ASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSK--KIQLLAVTHAPQ-VAARADRHFLVYK 504 (554) Q Consensus 428 aSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~--~~Qvi~ITH~pq-vAa~a~~h~~v~K 504 (554) +|||++=|+++|-.++ ...+.+||||.=+|++-.+...|-++|++|.+ ..-||+|||-.. ++.+||+=++..+ T Consensus 133 LSGGqkQRVaIA~aLa----~~P~iLllDEPTs~LD~~~~~~i~~ll~~L~~e~g~Tii~vTHdl~~~~~~aDrvivm~~ 208 (276) T PRK13634 133 LSGGQMRRVAIAGVLA----MEPEVLVLDEPTAGLDPKGRKEIMEMFYKLHKEKGLTTVLVTHSMEDAARYADQIVVMHK 208 (276) T ss_pred CCHHHHHHHHHHHHHH----CCCCEEEECCCCCCCCHHHHHHHHHHHHHHHHHCCCEEEEECCCHHHHHHHCCEEEEEEC T ss_conf 8999999999999997----299989976985427999999999999999996199999986799999997999999989 No 145 >PRK10253 iron-enterobactin transporter ATP-binding protein; Provisional Probab=98.17 E-value=2e-05 Score=54.71 Aligned_cols=73 Identities=21% Similarity=0.205 Sum_probs=59.8 Q ss_pred HCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHH--CCCEEEEECHHHHH-HHCCCEEEEEE Q ss_conf 0621579999999998436689976998034468887999999999999730--59399980837986-50176179999 Q gi|255764514|r 428 ASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSK--KIQLLAVTHAPQVA-ARADRHFLVYK 504 (554) Q Consensus 428 aSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~--~~Qvi~ITH~pqvA-a~a~~h~~v~K 504 (554) +||||+=|+++|-.++ ..++.++|||.-+|++-.+...+-+.|+++.+ ..-||+|||-...| .+||+=++..+ T Consensus 144 LSGGq~QRv~iAraL~----~~P~illLDEPts~LD~~~~~~i~~~i~~l~~~~g~tvi~vtHdl~~a~~~adrvivl~~ 219 (265) T PRK10253 144 LSGGQRQRAWIAMVLA----QETAIMLLDEPTTWLDISHQIDLLELLSELNREKGYTLAAVLHDLNQACRYASHLIALRE 219 (265) T ss_pred CCHHHHHHHHHHHHHH----CCCCEEEECCCCCCCCHHHHHHHHHHHHHHHHHHCCEEEEEECCHHHHHHHCCEEEEEEC T ss_conf 9988999999999985----699989981887668999999999999999985098999993599999986999999989 No 146 >PRK13548 hmuV hemin importer ATP-binding subunit; Provisional Probab=98.17 E-value=2.3e-05 Score=54.28 Aligned_cols=77 Identities=29% Similarity=0.318 Sum_probs=60.1 Q ss_pred HCCHHHHHHHHHHHHHHC--CCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHC-CCEEEEECHHHHH-HHCCCEEEEE Q ss_conf 062157999999999843--66899769980344688879999999999997305-9399980837986-5017617999 Q gi|255764514|r 428 ASGGELSRFLLALKIVLV--DQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSKK-IQLLAVTHAPQVA-ARADRHFLVY 503 (554) Q Consensus 428 aSGGE~Sr~~LAl~~~~~--~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~~-~Qvi~ITH~pqvA-a~a~~h~~v~ 503 (554) +||||+=|+++|-.++.. -...++.++|||.-+|++-.....+-++|+++++. .-||+|||-...| .+||+=++.. T Consensus 135 LSGGq~QRv~iAraL~q~~~~~~~P~lLlLDEPtsgLD~~~~~~i~~ll~~l~~~g~tvl~vtHdl~~~~~~aDrv~vl~ 214 (257) T PRK13548 135 LSGGEQQRVQLARVLAQLWEPGGGPRWLLLDEPTSALDLAHQHHVLRLARQLAERGAAVIVVLHDLNLAARYADRIVLLH 214 (257) T ss_pred CCHHHHHHHHHHHHHHHCCCCCCCCCEEEECCCCCCCCHHHHHHHHHHHHHHHHCCCEEEEEECCHHHHHHHCCEEEEEE T ss_conf 99999999999999962001047998899889876689999999999999998559999999278899999799999998 Q ss_pred E Q ss_conf 9 Q gi|255764514|r 504 K 504 (554) Q Consensus 504 K 504 (554) + T Consensus 215 ~ 215 (257) T PRK13548 215 Q 215 (257) T ss_pred C T ss_conf 9 No 147 >PRK11231 fecE iron-dicitrate transporter ATP-binding subunit; Provisional Probab=98.17 E-value=2.3e-05 Score=54.38 Aligned_cols=43 Identities=28% Similarity=0.543 Sum_probs=35.1 Q ss_pred EEEEECCE-------EEEEEEEECCCC-EEEEECCCCCCHHHHHHHHHHHH Q ss_conf 59994227-------899998873898-18998899978889999999871 Q gi|255764514|r 3 RLSIYNIV-------LIESLDIDFSAG-LSILSGDTGSGKSILLDALILVT 45 (554) Q Consensus 3 ~L~i~Nf~-------~i~~~~i~f~~G-l~vItGetGaGKS~ildAl~~~l 45 (554) .|+++|+. .++++++++.+| +++|.||||||||+++.+|.-++ T Consensus 2 ~L~v~nls~~yg~~~~L~~isl~i~~Gei~~liGpNGaGKSTLlk~i~Gl~ 52 (255) T PRK11231 2 TLRTENLTVGYGTKRILNDLSLSLPTGKITALIGPNGCGKSTLLKCFARLL 52 (255) T ss_pred EEEEEEEEEEECCEEEEECCEEEECCCCEEEEECCCCCHHHHHHHHHHCCC T ss_conf 899997999999999982308899899799999999981999999997598 No 148 >COG1131 CcmA ABC-type multidrug transport system, ATPase component [Defense mechanisms] Probab=98.16 E-value=2.1e-05 Score=54.58 Aligned_cols=36 Identities=25% Similarity=0.433 Sum_probs=31.6 Q ss_pred CCEEEEEEEEECCCC-EEEEECCCCCCHHHHHHHHHH Q ss_conf 227899998873898-189988999788899999998 Q gi|255764514|r 8 NIVLIESLDIDFSAG-LSILSGDTGSGKSILLDALIL 43 (554) Q Consensus 8 Nf~~i~~~~i~f~~G-l~vItGetGaGKS~ildAl~~ 43 (554) +...+++++++|.+| ++++.||||||||++|..|+= T Consensus 17 ~~~~l~~vs~~i~~Gei~gllG~NGAGKTTllk~l~G 53 (293) T COG1131 17 DKTALDGVSFEVEPGEIFGLLGPNGAGKTTLLKILAG 53 (293) T ss_pred CCEEEEEEEEEEECCEEEEEECCCCCCHHHHHHHHHC T ss_conf 8788860499982895999989999989999999967 No 149 >PRK13647 cbiO cobalt transporter ATP-binding subunit; Provisional Probab=98.16 E-value=1.9e-05 Score=54.91 Aligned_cols=73 Identities=18% Similarity=0.176 Sum_probs=60.8 Q ss_pred HCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHC-CCEEEEECHHHH-HHHCCCEEEEEE Q ss_conf 06215799999999984366899769980344688879999999999997305-939998083798-650176179999 Q gi|255764514|r 428 ASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSKK-IQLLAVTHAPQV-AARADRHFLVYK 504 (554) Q Consensus 428 aSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~~-~Qvi~ITH~pqv-Aa~a~~h~~v~K 504 (554) +|||++=|+++|-.++ ..++.+||||--+|++-.....+-+.|+++.+. .-||+|||-... +.+||+=++..+ T Consensus 139 LSGGqkqRvaiA~aL~----~~P~lliLDEPtagLDp~~~~~l~~~l~~L~~~G~Tvi~vtHdl~~~~~~aDrvivl~~ 213 (273) T PRK13647 139 LSYGQKKRVAIAGVLA----MEPDIIVLDEPMAYLDPRGKEELTAILNRLNNEGKTVIVATHDVDLALEWADQVVVLNA 213 (273) T ss_pred CCHHHHHHHHHHHHHH----HCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCEEEEEECCHHHHHHHCCEEEEEEC T ss_conf 9998999999999998----19999999797657999999999999999984899999994178999996999999989 No 150 >PRK13541 cytochrome c biogenesis protein CcmA; Provisional Probab=98.16 E-value=5.1e-06 Score=58.60 Aligned_cols=67 Identities=18% Similarity=0.131 Sum_probs=55.5 Q ss_pred HHCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHC-CCEEEEECHHHHHHHCC Q ss_conf 406215799999999984366899769980344688879999999999997305-93999808379865017 Q gi|255764514|r 427 LASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSKK-IQLLAVTHAPQVAARAD 497 (554) Q Consensus 427 iaSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~~-~Qvi~ITH~pqvAa~a~ 497 (554) -+|||++-|+++|..++ ..++.++|||.-+|++-.+...+-++++.+.+. .=|+++||++.+.-.|| T Consensus 123 ~LS~G~kqrv~iAral~----~~p~llllDEPt~~LD~~~~~~i~~li~~~~~~g~~ili~sH~~~~i~~a~ 190 (195) T PRK13541 123 SLSSGMQKVVALARLIA----CQSDLWLLDEVETNLSKENRDLLNNLIVMKANSGGIVLLSSHLESSIKSAQ 190 (195) T ss_pred HCCHHHHHHHHHHHHHH----HCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCEEEEECCCHHHHHHCC T ss_conf 59999999999999997----099999997876559999999999999999839999999837989994199 No 151 >PRK13650 cbiO cobalt transporter ATP-binding subunit; Provisional Probab=98.15 E-value=1.8e-05 Score=55.05 Aligned_cols=72 Identities=19% Similarity=0.270 Sum_probs=60.5 Q ss_pred HCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHH--CCCEEEEECHHHHHHHCCCEEEEE Q ss_conf 0621579999999998436689976998034468887999999999999730--593999808379865017617999 Q gi|255764514|r 428 ASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSK--KIQLLAVTHAPQVAARADRHFLVY 503 (554) Q Consensus 428 aSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~--~~Qvi~ITH~pqvAa~a~~h~~v~ 503 (554) +|||++=|+++|-.++ ..++.+||||.=+|++-.+...+-+.|+++.+ ..=||+|||-...++.||+=++.. T Consensus 138 LSGGQrQRvaIA~aLa----~~P~lLilDEPTs~LD~~~~~~i~~~l~~l~~~~g~Tvi~iTHdl~~v~~aDrvivm~ 211 (276) T PRK13650 138 LSGGQKQRVAIAGAVA----MRPKIIILDEATSMLDPEGRLELIKTIKNIRDDYQLTVISITHDLDEVALSDRVLVMK 211 (276) T ss_pred CCHHHHHHHHHHHHHH----CCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHCCCEEEEEEECHHHHHCCCEEEEEE T ss_conf 8999999999999997----3999999838866589999999999999999842989999957789996099999998 No 152 >cd03232 ABC_PDR_domain2 The pleiotropic drug resistance-like (PDR) family of ATP-binding cassette (ABC) transporters. PDR is a well-described phenomenon occurring in fungi and shares several similarities with processes in bacteria and higher eukaryotes. This PDR subfamily represents domain I of its (ABC-IM)2 organization. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds including sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins. Probab=98.15 E-value=1.5e-05 Score=55.59 Aligned_cols=73 Identities=25% Similarity=0.347 Sum_probs=59.1 Q ss_pred HCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCC-CEEEEECHH--HHHHHCCCEEEEEE Q ss_conf 062157999999999843668997699803446888799999999999973059-399980837--98650176179999 Q gi|255764514|r 428 ASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSKKI-QLLAVTHAP--QVAARADRHFLVYK 504 (554) Q Consensus 428 aSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~~~-Qvi~ITH~p--qvAa~a~~h~~v~K 504 (554) +||||+=|+++|..++ ..++.+++||.-+|++-.+...+-++|+++++.. -|+++||.| -+...+|+-+...+ T Consensus 109 LS~gqrqrv~iA~aL~----~~P~lllLDEPt~gLD~~~~~~i~~~l~~l~~~g~tiii~th~~~~~i~~~~Driivl~~ 184 (192) T cd03232 109 LSVEQRKRLTIGVELA----AKPSILFLDEPTSGLDSQAAYNIVRFLKKLADSGQAILCTIHQPSASIFEKFDRLLLLKR 184 (192) T ss_pred CCHHHHHHHHHHHHHH----CCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHCCEEEEECC T ss_conf 7976765899999984----499889984887688989999999999999969999999983637999987999999979 No 153 >PRK13549 xylose transporter ATP-binding subunit; Provisional Probab=98.14 E-value=0.00013 Score=49.44 Aligned_cols=100 Identities=19% Similarity=0.230 Sum_probs=73.6 Q ss_pred HCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCC-CEEEEECHHHH-HHHCCCEEEEEEE Q ss_conf 062157999999999843668997699803446888799999999999973059-39998083798-6501761799996 Q gi|255764514|r 428 ASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSKKI-QLLAVTHAPQV-AARADRHFLVYKT 505 (554) Q Consensus 428 aSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~~~-Qvi~ITH~pqv-Aa~a~~h~~v~K~ 505 (554) +|||++=|+++|-.++ ..++.+|+||.=+|++-.+...|.++|+++.+.- -||+|||=.-. +.++|+=++... T Consensus 406 LSGGq~QRv~iAraL~----~~P~iLilDEPT~GLD~~~~~~i~~ll~~l~~~G~tvl~iSHDl~~v~~~aDRV~Vm~~- 480 (513) T PRK13549 406 LSGGNQQKAILAKCLL----LNPRILILDEPTRGIDVGAKYEIYKLINQLVQQGVAIIVISSELPEVLGLSDRVLVMHE- 480 (513) T ss_pred CCHHHHHHHHHHHHHH----CCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCEEEEEECCHHHHHHHCCEEEEEEC- T ss_conf 9999999999999997----19989999798668999999999999999995799999991868999986999999989- Q ss_pred ECCCCCCEEEEEEEECCHHHH--HHHHHHHHCCCCCHH Q ss_conf 216875258999997598899--999999866880028 Q gi|255764514|r 506 NKPDDTQRIETYVAVLTPQER--REEIARMLAGSHITE 541 (554) Q Consensus 506 ~~~~~~~~~~~~i~~l~~~~r--~~Eiarml~g~~~~~ 541 (554) | + -+..++.++- -+-++-|+||+...+ T Consensus 481 ---G---~---I~~~~~~~~~~~e~~~~~~~~~~~~~~ 509 (513) T PRK13549 481 ---G---K---LKGDLINHNLTQEQVMEAALRSEHHVE 509 (513) T ss_pred ---C---E---EEEEECHHHCCHHHHHHHHHCCCCCHH T ss_conf ---9---9---998847475899999999857985233 No 154 >PRK10895 putative ABC transporter ATP-binding protein YhbG; Provisional Probab=98.14 E-value=2.3e-05 Score=54.35 Aligned_cols=73 Identities=22% Similarity=0.315 Sum_probs=60.1 Q ss_pred HCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHC-CCEEEEECHHH-HHHHCCCEEEEEE Q ss_conf 06215799999999984366899769980344688879999999999997305-93999808379-8650176179999 Q gi|255764514|r 428 ASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSKK-IQLLAVTHAPQ-VAARADRHFLVYK 504 (554) Q Consensus 428 aSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~~-~Qvi~ITH~pq-vAa~a~~h~~v~K 504 (554) +|||++=|+++|..++ ..++.+++||.-+|++-.+...+-++++.+.+. .=||+|||-+. +...+|+-+.+.+ T Consensus 138 LSgG~kqrv~iAraL~----~~P~illLDEPt~gLD~~~~~~i~~~l~~l~~~g~tvl~~tHdl~~~~~~~drv~vl~~ 212 (241) T PRK10895 138 LSGGERRRVEIARALA----ANPKFILLDEPFAGVDPISVIDIKRIIEHLRDSGLGVLITDHNVRETLAVCERAYIVSQ 212 (241) T ss_pred CCHHHHHHHHHHHHHH----CCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCEEEEECCCHHHHHHHCCEEEEEEC T ss_conf 8988899999999996----69988999587547999999999999999996499999990729999997999999989 No 155 >COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] Probab=98.14 E-value=5.1e-06 Score=58.62 Aligned_cols=75 Identities=29% Similarity=0.398 Sum_probs=62.7 Q ss_pred HHCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHC--CCEEEEECHHHHHHHCCCEEEEEE Q ss_conf 406215799999999984366899769980344688879999999999997305--939998083798650176179999 Q gi|255764514|r 427 LASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSKK--IQLLAVTHAPQVAARADRHFLVYK 504 (554) Q Consensus 427 iaSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~~--~Qvi~ITH~pqvAa~a~~h~~v~K 504 (554) -+||||+-|+++|..++ ..+|.+++||-=++++=.....|=+.++++++. .=||+|+|=|..|++--.|+.+-| T Consensus 138 ~LSGGerQrv~iAraLa----Q~~~iLLLDEPTs~LDi~~Q~evl~ll~~l~~~~g~tvv~vlHDln~A~ryad~~i~l~ 213 (258) T COG1120 138 ELSGGERQRVLIARALA----QETPILLLDEPTSHLDIAHQIEVLELLRDLNREKGLTVVMVLHDLNLAARYADHLILLK 213 (258) T ss_pred CCCHHHHHHHHHHHHHH----CCCCEEEECCCCCCCCHHHHHHHHHHHHHHHHHCCCEEEEEECCHHHHHHHCCEEEEEE T ss_conf 16866889999999984----58997882797200387779999999999998559789999559889997478899997 Q ss_pred E Q ss_conf 6 Q gi|255764514|r 505 T 505 (554) Q Consensus 505 ~ 505 (554) . T Consensus 214 ~ 214 (258) T COG1120 214 D 214 (258) T ss_pred C T ss_conf 9 No 156 >PRK09493 glnQ glutamine ABC transporter ATP-binding protein; Reviewed Probab=98.14 E-value=2.1e-05 Score=54.64 Aligned_cols=73 Identities=23% Similarity=0.362 Sum_probs=59.6 Q ss_pred HCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHC-CCEEEEECHHHHHHH-CCCEEEEEE Q ss_conf 06215799999999984366899769980344688879999999999997305-939998083798650-176179999 Q gi|255764514|r 428 ASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSKK-IQLLAVTHAPQVAAR-ADRHFLVYK 504 (554) Q Consensus 428 aSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~~-~Qvi~ITH~pqvAa~-a~~h~~v~K 504 (554) +|||++=|+++|-.++ ..++.+|+||.=+|++-.+...+-+.|+++.+. .=||+|||-...|.. ||+-++..+ T Consensus 137 LSGGq~QRvaiAraL~----~~P~lLllDEPt~~LD~~~~~~i~~ll~~l~~~g~tvi~vtHdl~~~~~~adri~vl~~ 211 (240) T PRK09493 137 LSGGQQQRVAIARALA----VKPKLMLFDEPTSALDPELRHEVLKVMQDLAEEGMTMVIVTHEIGFAEKVASRLIFIDK 211 (240) T ss_pred CCHHHHHHHHHHHHHH----CCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCEEEEECCCHHHHHHHCCEEEEEEC T ss_conf 8999999999998773----59999999088766899999999999999997699899994799999996999999989 No 157 >PRK13541 cytochrome c biogenesis protein CcmA; Provisional Probab=98.14 E-value=1.7e-05 Score=55.10 Aligned_cols=40 Identities=30% Similarity=0.463 Sum_probs=31.3 Q ss_pred EEECCEEEEEEEEECCCC-EEEEECCCCCCHHHHHHHHHHHH Q ss_conf 994227899998873898-18998899978889999999871 Q gi|255764514|r 5 SIYNIVLIESLDIDFSAG-LSILSGDTGSGKSILLDALILVT 45 (554) Q Consensus 5 ~i~Nf~~i~~~~i~f~~G-l~vItGetGaGKS~ildAl~~~l 45 (554) ...+-.++ ++++.|.+| +++|+|+||||||+++..|+-++ T Consensus 10 ~~~~~~l~-disl~i~~G~i~~i~G~NGsGKSTLlk~i~Gl~ 50 (195) T PRK13541 10 NIEQKNLF-DLSITFLPSAITYIKGANGCGKSSLLRMIAGIM 50 (195) T ss_pred EECCEEEE-EEEEEECCCCEEEEECCCCCCHHHHHHHHHCCC T ss_conf 96995999-777787799799999999981999999996798 No 158 >PRK11247 ssuB aliphatic sulfonates transport ATP-binding subunit; Provisional Probab=98.14 E-value=2.4e-05 Score=54.15 Aligned_cols=73 Identities=27% Similarity=0.295 Sum_probs=60.1 Q ss_pred HCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCC--EEEEECHHHHH-HHCCCEEEEEE Q ss_conf 0621579999999998436689976998034468887999999999999730593--99980837986-50176179999 Q gi|255764514|r 428 ASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSKKIQ--LLAVTHAPQVA-ARADRHFLVYK 504 (554) Q Consensus 428 aSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~~~Q--vi~ITH~pqvA-a~a~~h~~v~K 504 (554) +|||++-|+++|-.++ ..++.+|+||.=+|++-.+...+-+.|+++.+... ||.|||-...| +.||+=++..+ T Consensus 134 LSGGqkQRvaiAraL~----~~P~lLlLDEPtsgLD~~~~~~i~~ll~~L~~e~g~TIi~vTHdl~ea~~laDRI~vm~~ 209 (257) T PRK11247 134 LSGGQKQRVALARALI----HRPRLLLLDEPLGALDALTRIEMQDLIESLWQQHGFTVLLVTHDVSEAVAMADRVLLIEE 209 (257) T ss_pred CCHHHHHHHHHHHHHH----CCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHHCCEEEEECCCHHHHHHHCCEEEEEEC T ss_conf 8999999999999984----599999980987657999999999999999996098999988799999996999999989 No 159 >cd03267 ABC_NatA_like Similar in sequence to NatA, this is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled to proton or K+ uptake. NatB possess six putative membrane spanning regions at its C-terminus. In B. subtilis, NatAB is inducible by agents such as ethanol and protonophores, which lower the protonmotive force across the membrane. The closest sequence similarity to NatA is exhibited by DrrA of the two-component daunomycin- and doxorubicin-efflux system. Hence, the functional NatAB is presumably assembled with two copies of the single ATP-binding protein and the single intergral membrane protein. Probab=98.14 E-value=3e-05 Score=53.56 Aligned_cols=73 Identities=21% Similarity=0.201 Sum_probs=58.9 Q ss_pred HHCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCC--CEEEEECHHHHHH-HCCCEEEEE Q ss_conf 4062157999999999843668997699803446888799999999999973059--3999808379865-017617999 Q gi|255764514|r 427 LASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSKKI--QLLAVTHAPQVAA-RADRHFLVY 503 (554) Q Consensus 427 iaSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~~~--Qvi~ITH~pqvAa-~a~~h~~v~ 503 (554) -+|||++-|++||..++ ..++.++|||.=+|++-.....+-++|+++.+.. =||.+||.-..|. .+|+=+++. T Consensus 153 ~LSgG~rqrv~ia~aL~----~~P~lllLDEPt~gLD~~~~~~i~~~l~~l~~~~g~till~tH~l~ev~~~~Drv~vl~ 228 (236) T cd03267 153 QLSLGQRMRAEIAAALL----HEPEILFLDEPTIGLDVVAQENIRNFLKEYNRERGTTVLLTSHYMKDIEALARRVLVID 228 (236) T ss_pred HCCHHHHHHHHHHHHHH----CCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHCCCEEEEECCCHHHHHHHCCEEEEEE T ss_conf 69999999999999996----79999999798768899999999999999997389899998887899999799999998 No 160 >COG4913 Uncharacterized protein conserved in bacteria [Function unknown] Probab=98.13 E-value=0.00085 Score=43.98 Aligned_cols=45 Identities=31% Similarity=0.517 Sum_probs=40.1 Q ss_pred CCEEEEECCEEEEEEEEECCCCEEEEECCCCCCHHHHHHHHHHHH Q ss_conf 925999422789999887389818998899978889999999871 Q gi|255764514|r 1 MTRLSIYNIVLIESLDIDFSAGLSILSGDTGSGKSILLDALILVT 45 (554) Q Consensus 1 L~~L~i~Nf~~i~~~~i~f~~Gl~vItGetGaGKS~ildAl~~~l 45 (554) |.+|.+-|+..|.-..|....|=-.+||..|||||++||||.-+| T Consensus 17 L~~iqliNWGTF~T~~~~~T~~G~LvTG~~GSGKSTLIDAITavL 61 (1104) T COG4913 17 LSRIQLINWGTFHTVDIPVTREGILVTGGSGSGKSTLIDAITAVL 61 (1104) T ss_pred EEEEEEEECCCCCEEEEEEECCCEEEECCCCCCCHHHHHHHHHHH T ss_conf 667788502443124666751645774688887010999899984 No 161 >cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea. Only very few species lack representatives of the siderophore family transporters. The E. coli BtuCD protein is an ABC transporter mediating vitamin B12 uptake. The two ATP-binding cassettes (BtuD) are in close contact with each other, as are the two membrane-spanning subunits (BtuC); this arrangement is distinct from that observed for the E. coli lipid flippase MsbA. The BtuC subunits provide 20 transmembrane helices grouped around a translocation pathway that is closed to the cytoplasm by a gate region, whereas the dimer arrangement of the BtuD subunits resembles the ATP-bound form of the Rad50 DNA repair enzyme. A prominent cytoplasmic loop of BtuC forms the contact region with the ATP-binding cassette and represent a conserved motif among the ABC transporters. Probab=98.13 E-value=2.4e-05 Score=54.19 Aligned_cols=73 Identities=30% Similarity=0.364 Sum_probs=59.1 Q ss_pred HCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHC--CCEEEEECHHHHHHHCCCEEEEEE Q ss_conf 06215799999999984366899769980344688879999999999997305--939998083798650176179999 Q gi|255764514|r 428 ASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSKK--IQLLAVTHAPQVAARADRHFLVYK 504 (554) Q Consensus 428 aSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~~--~Qvi~ITH~pqvAa~a~~h~~v~K 504 (554) +|||++=|+++|..++ ..++++||||.=+|++-.+...+-+.++++.+. .=||+|||-...|..=-.++.|-+ T Consensus 98 LSGGqkQrv~iA~aL~----~~P~ililDEPts~LD~~~~~~i~~~i~~l~~~~~~tii~itHdl~~~~~~~d~i~vm~ 172 (180) T cd03214 98 LSGGERQRVLLARALA----QEPPILLLDEPTSHLDIAHQIELLELLRRLARERGKTVVMVLHDLNLAARYADRVILLK 172 (180) T ss_pred CCHHHHHHHHHHHHHH----HCCCEEEECCCCCCCCHHHHHHHHHHHHHHHHHCCCEEEEEECCHHHHHHHCCEEEEEE T ss_conf 7999999999999998----68964788587544799999999999999998469899999079899999799999997 No 162 >cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids. RLI's are not transport proteins, and thus cluster with a group of soluble proteins that lack the transmembrane components commonly found in other members of the family. Structurally, RLI's have an N-terminal Fe-S domain and two nucleotide-binding domains, which are arranged to form two composite active sites in their interface cleft. RLI is one of the most conserved enzymes between archaea and eukaryotes with a sequence identity more than 48%. The high degree of evolutionary conservation suggests that RLI performs a central role in archaeal and eukaryotic physiology. Probab=98.13 E-value=2e-05 Score=54.75 Aligned_cols=73 Identities=25% Similarity=0.280 Sum_probs=61.5 Q ss_pred HCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCC--EEEEECHHHHHH-HCCCEEEEEE Q ss_conf 0621579999999998436689976998034468887999999999999730593--999808379865-0176179999 Q gi|255764514|r 428 ASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSKKIQ--LLAVTHAPQVAA-RADRHFLVYK 504 (554) Q Consensus 428 aSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~~~Q--vi~ITH~pqvAa-~a~~h~~v~K 504 (554) +||||+-|+++|-.++ ..++.++|||-=+|++-.....+-+.++++.++.. |++|||--..|. .+|+=+.+.. T Consensus 72 LSGGqrQRv~iAral~----~~p~lllLDEPts~LD~~~r~~i~~~ik~l~~~~~~Tvl~vsHdl~~a~~~aDrI~vl~g 147 (177) T cd03222 72 LSGGELQRVAIAAALL----RNATFYLFDEPSAYLDIEQRLNAARAIRRLSEEGKKTALVVEHDLAVLDYLSDRIHVFEG 147 (177) T ss_pred CCHHHHHHHHHHHHHH----CCCCEEEECCCCCCCCHHHHHHHHHHHHHHHHHCCCEEEEECCCHHHHHHHCCEEEEEEC T ss_conf 7989999999999982----399999974886538999999999999999996597799985889999986999999938 No 163 >PRK13638 cbiO cobalt transporter ATP-binding subunit; Provisional Probab=98.13 E-value=2.4e-05 Score=54.14 Aligned_cols=74 Identities=16% Similarity=0.197 Sum_probs=59.2 Q ss_pred HHCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHH-CCCEEEEECHH-HHHHHCCCEEEEEE Q ss_conf 40621579999999998436689976998034468887999999999999730-59399980837-98650176179999 Q gi|255764514|r 427 LASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSK-KIQLLAVTHAP-QVAARADRHFLVYK 504 (554) Q Consensus 427 iaSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~-~~Qvi~ITH~p-qvAa~a~~h~~v~K 504 (554) -+|||++=|+++|-.++ ..++.++|||.=+|++-.....+-++|+++.+ ..=||+|||-. .|+..+|+=++... T Consensus 136 ~LSgGqkQrv~iAraL~----~~P~lLlLDEPtagLD~~~~~~i~~ll~~l~~~G~tiiivsHdl~~v~~~aDrv~vl~~ 211 (271) T PRK13638 136 CLSHGQKKRVAIAGALV----LQARYLLLDEPTAGLDPAGRTQMIAIIRRIVAQGNHVIISSHDIDLIYEISDAVYVLRQ 211 (271) T ss_pred HCCHHHHHHHHHHHHHH----CCCCEEEECCCCCCCCHHHHHHHHHHHHHHHHCCCEEEEECCCHHHHHHHCCEEEEEEC T ss_conf 59999999999999996----59998998387545899999999999999997899999984888999996999999989 No 164 >PRK09544 znuC high-affinity zinc transporter ATPase; Reviewed Probab=98.13 E-value=2.8e-05 Score=53.73 Aligned_cols=71 Identities=30% Similarity=0.387 Sum_probs=58.8 Q ss_pred HCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHC--CCEEEEECHHHHH-HHCCCEEEE Q ss_conf 06215799999999984366899769980344688879999999999997305--9399980837986-501761799 Q gi|255764514|r 428 ASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSKK--IQLLAVTHAPQVA-ARADRHFLV 502 (554) Q Consensus 428 aSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~~--~Qvi~ITH~pqvA-a~a~~h~~v 502 (554) +||||+-|+++|-.++ ..++.+||||.-+|++-.+...+-+.|+++.+. .=||+|||--..| ..||+=++. T Consensus 121 LSGGq~QRv~iAraL~----~~P~lLiLDEPTsgLD~~~~~~i~~li~~L~~e~g~til~vtHDl~~~~~~aDrIivL 194 (251) T PRK09544 121 LSGGETQRVLLARALL----NRPQLLVLDEPTQGVDVNGQVALYDLIDQLRRELDCAVLMVSHDLHLVMAKTDEVLCL 194 (251) T ss_pred CCHHHHHHHHHHHHHH----CCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHCCCEEEEEECCHHHHHHHCCEEEEE T ss_conf 8999999999999997----4999899809864689999999999999999832989999906899999869999999 No 165 >PRK13639 cbiO cobalt transporter ATP-binding subunit; Provisional Probab=98.12 E-value=2.3e-05 Score=54.35 Aligned_cols=74 Identities=24% Similarity=0.284 Sum_probs=60.7 Q ss_pred HHCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCC-CEEEEECHHHHHH-HCCCEEEEEE Q ss_conf 4062157999999999843668997699803446888799999999999973059-3999808379865-0176179999 Q gi|255764514|r 427 LASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSKKI-QLLAVTHAPQVAA-RADRHFLVYK 504 (554) Q Consensus 427 iaSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~~~-Qvi~ITH~pqvAa-~a~~h~~v~K 504 (554) -+|||++=|+++|-.++ ..++.+||||.-+|++-.....+-+.|+++.+.. =||+|||-...|+ +||+=++..+ T Consensus 137 ~LSGGqkqRVaiA~aLa----~~P~iliLDEPTagLDp~~~~~i~~ll~~l~~~G~Tii~iTHdm~~~~~~adrv~vl~~ 212 (275) T PRK13639 137 HLSGGQKKRVAIAGILA----MNPEIMVLDEPTSGLDPMGASQIMKLLYDLNKEGITIIISTHDVDLVPIYANKIYVLND 212 (275) T ss_pred HCCHHHHHHHHHHHHHH----CCCCEEEECCCCCCCCHHHHHHHHHHHHHHHHCCCEEEEECCCHHHHHHHCCEEEEEEC T ss_conf 49999999999988873----69989997797554899999999999999997699999993899999996999999989 No 166 >PRK11147 ABC transporter ATPase component; Reviewed Probab=98.12 E-value=1.2e-05 Score=56.19 Aligned_cols=77 Identities=23% Similarity=0.300 Sum_probs=61.7 Q ss_pred CCHHHHHHCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCEEEEECHHHHH-HHCCCE Q ss_conf 3113544062157999999999843668997699803446888799999999999973059399980837986-501761 Q gi|255764514|r 421 PGPLMKLASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSKKIQLLAVTHAPQVA-ARADRH 499 (554) Q Consensus 421 ~~pl~kiaSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~~~Qvi~ITH~pqvA-a~a~~h 499 (554) .+|++ .+||||++|++||..++ .++.++|+||.-.+++=.+-+.+.+.|....- =||+|||=..-- ..|+.. T Consensus 435 ~~~v~-~LSGGEk~Rl~LA~~l~----~~pnlLiLDEPTNhLDi~s~e~Le~aL~~y~G--tvl~VSHDr~fl~~~~~~~ 507 (632) T PRK11147 435 MTPVK-ALSGGERNRLLLARLFL----KPSNLLILDEPTNDLDVETLELLEELLDSYQG--TLLLVSHDRQFVDNTVTEC 507 (632) T ss_pred CCCCC-CCCHHHHHHHHHHHHHC----CCCCEEEEECCCCCCCHHHHHHHHHHHHHCCC--EEEEEECCHHHHHHHCCEE T ss_conf 39155-39999999999999857----79978999898765799999999999985898--3999979899998534569 Q ss_pred EEEEE Q ss_conf 79999 Q gi|255764514|r 500 FLVYK 504 (554) Q Consensus 500 ~~v~K 504 (554) |.+.. T Consensus 508 ~~~~~ 512 (632) T PRK11147 508 WIFEG 512 (632) T ss_pred EEEEC T ss_conf 99956 No 167 >PRK13544 consensus Probab=98.11 E-value=6.5e-06 Score=57.91 Aligned_cols=41 Identities=32% Similarity=0.412 Sum_probs=34.6 Q ss_pred EEEECCEEEEEEEEECCCC-EEEEECCCCCCHHHHHHHHHHH Q ss_conf 9994227899998873898-1899889997888999999987 Q gi|255764514|r 4 LSIYNIVLIESLDIDFSAG-LSILSGDTGSGKSILLDALILV 44 (554) Q Consensus 4 L~i~Nf~~i~~~~i~f~~G-l~vItGetGaGKS~ildAl~~~ 44 (554) ....|..+++++++.|.+| +++|+||||||||+++.+|.=. T Consensus 9 ~~yg~k~il~~vs~~i~~Gei~~l~G~NGsGKSTLl~~i~Gl 50 (208) T PRK13544 9 CIRNNKVLFSNLSFTAKQNSLTLVIGNNGSGKTSLLRLLAGL 50 (208) T ss_pred EEECCEEEEECCEEEECCCCEEEEECCCCCCHHHHHHHHHCC T ss_conf 999999999441589829949999999999899999999588 No 168 >COG4717 Uncharacterized conserved protein [Function unknown] Probab=98.11 E-value=0.00095 Score=43.65 Aligned_cols=103 Identities=17% Similarity=0.223 Sum_probs=64.5 Q ss_pred CCEEEEECCEEEEEEEEECCCC-EEEEECCCCCCHHHHHHHHH-HHHCCCCCCCC--C--CCCCCE-EEEEEEEECCCCH Q ss_conf 9259994227899998873898-18998899978889999999-87147325331--1--289725-8999999728973 Q gi|255764514|r 1 MTRLSIYNIVLIESLDIDFSAG-LSILSGDTGSGKSILLDALI-LVTGGRGDGGL--V--RRHAEK-GQVVAVFEISHLP 73 (554) Q Consensus 1 L~~L~i~Nf~~i~~~~i~f~~G-l~vItGetGaGKS~ildAl~-~~lG~r~~~~~--I--r~g~~~-a~Ve~~F~~~~~~ 73 (554) |.+|+|-.|.-|.+..++|++. |.||+|||-||||+|+.-|. .+||-..++.. . +.|... +.+.+. T Consensus 3 I~sl~I~gYGKFs~r~~df~~s~f~vI~G~NEAGKSTl~sFI~smlFGfP~~sk~~~~eP~~Gg~yGG~L~~~------- 75 (984) T COG4717 3 IQSLEIVGYGKFSERHFDFGESKFQVIYGENEAGKSTLFSFIHSMLFGFPTSSKYPRLEPKQGGQYGGRLVAI------- 75 (984) T ss_pred EEEEEEEECCCHHHHHHHCCCCCEEEEECCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCEEEEE------- T ss_conf 2688864014066655404678447984576311777999999998178887878887855478746579886------- Q ss_pred HHHHHHHHCCCCCCCCEEEEEEE-ECCCC-EEEEECCEEEECHHHHHHH Q ss_conf 78888874789888838999999-43897-7999999884101122211 Q gi|255764514|r 74 ALEILFAEANLTLEKHVILRRVQ-FPDGR-TKAYVNDQVVSVNFMRAVG 120 (554) Q Consensus 74 ~~~~~~~~~~~~~~~~~iirR~i-~~~Gk-S~~~INg~~v~~~~L~~l~ 120 (554) .+..+.+.|.|.- +..|. +.|+-||..-+...|..+. T Consensus 76 ----------~~~~~~~~IER~kgsa~gdvkvylpdG~v~~~~~L~k~l 114 (984) T COG4717 76 ----------DREGGAYRIERNKGSAIGDVKVYLPDGNVGSKTLLSKLL 114 (984) T ss_pred ----------CCCCCEEEEEECCCCCCCCCEEECCCCCCCCHHHHHHHH T ss_conf ----------288864899843676568703778998745058999997 No 169 >PRK09580 sufC cysteine desulfurase ATPase component; Reviewed Probab=98.11 E-value=6.8e-06 Score=57.79 Aligned_cols=40 Identities=28% Similarity=0.495 Sum_probs=33.0 Q ss_pred EEEECCEEEEEEEEECCCC-EEEEECCCCCCHHHHHHHHHH Q ss_conf 9994227899998873898-189988999788899999998 Q gi|255764514|r 4 LSIYNIVLIESLDIDFSAG-LSILSGDTGSGKSILLDALIL 43 (554) Q Consensus 4 L~i~Nf~~i~~~~i~f~~G-l~vItGetGaGKS~ildAl~~ 43 (554) .+..+...++++++++.+| +++|+||||||||+++.+|.- T Consensus 9 ~~~~~~~vL~~isl~i~~Gei~~iiG~nGaGKSTLl~~i~G 49 (248) T PRK09580 9 VSVEDKAILRGLNLEVRPGEVHAIMGPNGSGKSTLSATLAG 49 (248) T ss_pred EEECCEEEEECCEEEECCCCEEEEECCCCCCHHHHHHHHHC T ss_conf 99899999965188984997999999999999999999837 No 170 >PRK13543 cytochrome c biogenesis protein CcmA; Provisional Probab=98.10 E-value=3.8e-05 Score=52.90 Aligned_cols=73 Identities=18% Similarity=0.176 Sum_probs=57.3 Q ss_pred HCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHH-CCCEEEEECHHHHHHHCCCEEEEEE Q ss_conf 0621579999999998436689976998034468887999999999999730-5939998083798650176179999 Q gi|255764514|r 428 ASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSK-KIQLLAVTHAPQVAARADRHFLVYK 504 (554) Q Consensus 428 aSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~-~~Qvi~ITH~pqvAa~a~~h~~v~K 504 (554) +|||++-|++||..++ .+.|.++|||.-+|++-.+...+.++|+.+.+ ..=||++||-+..|..--.++.|-| T Consensus 138 LSgGqkqRv~lA~al~----~~p~illLDEPt~~LD~~~~~~l~~~l~~~~~~g~tvl~~tHd~~~~~~~adRi~~L~ 211 (214) T PRK13543 138 LSAGQRKRLALARLWL----SPAPLWLLDEPYANLDLEGITLVNRMISAHLRGGGAALVTTHGAYAAPPVRTRMLTLE 211 (214) T ss_pred CCHHHHHHHHHHHHHH----CCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCEEEEECCCHHHHHHHCCEEEEEE T ss_conf 8999999999999985----7999999809988899999999999999998679999999199899998699999980 No 171 >COG4559 ABC-type hemin transport system, ATPase component [Inorganic ion transport and metabolism] Probab=98.10 E-value=4.3e-06 Score=59.11 Aligned_cols=44 Identities=30% Similarity=0.440 Sum_probs=35.5 Q ss_pred EEEEECCEEEEEEEEECCCC-EEEEECCCCCCHHHHHHHHHHHHC Q ss_conf 59994227899998873898-189988999788899999998714 Q gi|255764514|r 3 RLSIYNIVLIESLDIDFSAG-LSILSGDTGSGKSILLDALILVTG 46 (554) Q Consensus 3 ~L~i~Nf~~i~~~~i~f~~G-l~vItGetGaGKS~ildAl~~~lG 46 (554) +.++..=.+++.+++++-|| +++|.||||||||++|.+|+-=|. T Consensus 8 s~~~~Gr~ll~~vsl~~~pGev~ailGPNGAGKSTlLk~LsGel~ 52 (259) T COG4559 8 SYSLAGRRLLDGVSLDLRPGEVLAILGPNGAGKSTLLKALSGELS 52 (259) T ss_pred EEEEECCEECCCCCEECCCCCEEEEECCCCCCHHHHHHHHHCCCC T ss_conf 898411011047315416872799988898658889998617637 No 172 >PRK13539 cytochrome c biogenesis protein CcmA; Provisional Probab=98.10 E-value=6.7e-06 Score=57.82 Aligned_cols=40 Identities=33% Similarity=0.418 Sum_probs=34.1 Q ss_pred EEEECCEEEEEEEEECCCC-EEEEECCCCCCHHHHHHHHHH Q ss_conf 9994227899998873898-189988999788899999998 Q gi|255764514|r 4 LSIYNIVLIESLDIDFSAG-LSILSGDTGSGKSILLDALIL 43 (554) Q Consensus 4 L~i~Nf~~i~~~~i~f~~G-l~vItGetGaGKS~ildAl~~ 43 (554) .+..+..+++++++.+.+| +++|+||||||||+++.+|.- T Consensus 10 ~~~g~~~il~~vsf~i~~Gei~~l~G~NGaGKTTLlk~i~G 50 (206) T PRK13539 10 CVRGGRVVFSGLSFTLAAGEALVLTGPNGSGKTTLLRLLAG 50 (206) T ss_pred EEECCEEEECCCEEEECCCCEEEEECCCCCCHHHHHHHHHC T ss_conf 99999999815078986994999989999989999999958 No 173 >TIGR00972 3a0107s01c2 phosphate ABC transporter, ATP-binding protein; InterPro: IPR005670 This is a family of phosphate transport system permease proteins.; GO: 0005315 inorganic phosphate transmembrane transporter activity, 0015114 phosphate transmembrane transporter activity, 0006817 phosphate transport, 0016020 membrane. Probab=98.10 E-value=3.5e-06 Score=59.73 Aligned_cols=37 Identities=27% Similarity=0.488 Sum_probs=31.4 Q ss_pred CCEEEEEEEEECCCC-EEEEECCCCCCHHHHHHHHHHH Q ss_conf 227899998873898-1899889997888999999987 Q gi|255764514|r 8 NIVLIESLDIDFSAG-LSILSGDTGSGKSILLDALILV 44 (554) Q Consensus 8 Nf~~i~~~~i~f~~G-l~vItGetGaGKS~ildAl~~~ 44 (554) +|.-+++++++|.++ .|+|+||+|+|||++|-+|+=. T Consensus 13 ~~~AL~~i~~~I~~n~vTAlIGPSGCGKSTlLR~lNRM 50 (248) T TIGR00972 13 EKEALKNINLDIPKNQVTALIGPSGCGKSTLLRSLNRM 50 (248) T ss_pred CEEEEECCCCEECCCEEEEEECCCCCCHHHHHHHHHHH T ss_conf 41786215620037705898778898678999998877 No 174 >cd03298 ABC_ThiQ_thiamine_transporter ABC-type thiamine tranport system; part of the binding-protein-dependent transport system tbpA-thiPQ for thiamine and TPP. Probably responsible for the translocation of thiamine across the membrane. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins. Probab=98.10 E-value=3.1e-05 Score=53.50 Aligned_cols=72 Identities=32% Similarity=0.403 Sum_probs=59.4 Q ss_pred HCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHC--CCEEEEECHHHHHHH-CCCEEEEE Q ss_conf 06215799999999984366899769980344688879999999999997305--939998083798650-17617999 Q gi|255764514|r 428 ASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSKK--IQLLAVTHAPQVAAR-ADRHFLVY 503 (554) Q Consensus 428 aSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~~--~Qvi~ITH~pqvAa~-a~~h~~v~ 503 (554) +||||+-|+++|-.++ ..+|.+++||.=++++-.+...+-+.++++.+. .=||.|||-|..|.. ||+=+... T Consensus 129 LSGGqkQRvaiARAL~----~~P~ilLlDEPts~LD~~~~~~l~~~l~~l~~~~~~Tvi~vTHd~~ea~~~adriivl~ 203 (211) T cd03298 129 LSGGERQRVALARVLV----RDKPVLLLDEPFAALDPALRAEMLDLVLDLHAETKMTVLMVTHQPEDAKRLAQRVVFLD 203 (211) T ss_pred CCHHHHHHHHHHHHHH----CCCCEEEECCCCCCCCHHHHHHHHHHHHHHHHHHCCEEEEECCCHHHHHHHCCEEEEEE T ss_conf 8989999999999986----59999997188765598999999999999999749989999889999999699999998 No 175 >PRK13651 cobalt transporter ATP-binding subunit; Provisional Probab=98.09 E-value=3e-05 Score=53.58 Aligned_cols=73 Identities=29% Similarity=0.334 Sum_probs=59.6 Q ss_pred HCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHC-CCEEEEECHHH-HHHHCCCEEEEEE Q ss_conf 06215799999999984366899769980344688879999999999997305-93999808379-8650176179999 Q gi|255764514|r 428 ASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSKK-IQLLAVTHAPQ-VAARADRHFLVYK 504 (554) Q Consensus 428 aSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~~-~Qvi~ITH~pq-vAa~a~~h~~v~K 504 (554) +|||++=|+++|-.++. .++.++|||.=+|++-.....|-+.|++|.+. .-||+|||--. |+.+||+=+...+ T Consensus 162 LSGGqkqRVaIA~~La~----~P~iLlLDEPTagLDp~~~~~i~~~l~~L~~~G~TVI~vTHdm~~v~~~adRvivl~~ 236 (304) T PRK13651 162 LSGGQKRRVALAGILAM----EPDFLVFDEPTAGLDPQGVKEILEIFDTLNKKGKTIILVTHDLDNVLEWTKRTIFFKD 236 (304) T ss_pred CCHHHHHHHHHHHHHHC----CCCEEEECCCCCCCCHHHHHHHHHHHHHHHHCCCEEEEECCCHHHHHHHCCEEEEEEC T ss_conf 89999999999998845----9999997298665898999999999999997799999986789999997999999989 No 176 >COG4604 CeuD ABC-type enterochelin transport system, ATPase component [Inorganic ion transport and metabolism] Probab=98.09 E-value=3.8e-06 Score=59.43 Aligned_cols=41 Identities=24% Similarity=0.464 Sum_probs=34.7 Q ss_pred ECCEEEEEEEEECCC-CEEEEECCCCCCHHHHHHHHHHHHCC Q ss_conf 422789999887389-81899889997888999999987147 Q gi|255764514|r 7 YNIVLIESLDIDFSA-GLSILSGDTGSGKSILLDALILVTGG 47 (554) Q Consensus 7 ~Nf~~i~~~~i~f~~-Gl~vItGetGaGKS~ildAl~~~lG~ 47 (554) .+=..+++++++|.+ |+|.|+||||||||++|..++=++.. T Consensus 12 ~~~~vl~~isl~i~~g~iTs~IGPNGAGKSTLLS~~sRL~~~ 53 (252) T COG4604 12 GTKVVLDDVSLDIPKGGITSIIGPNGAGKSTLLSMMSRLLKK 53 (252) T ss_pred CCEEEECCCEEEECCCCEEEEECCCCCCHHHHHHHHHHHCCC T ss_conf 877765361454158863688889986488899999985266 No 177 >cd03264 ABC_drug_resistance_like ABC-type multidrug transport system, ATPase component. The biological function of this family is not well characterized, but display ABC domains similar to members of ABCA subfamily. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins. Probab=98.09 E-value=4.1e-05 Score=52.64 Aligned_cols=73 Identities=21% Similarity=0.233 Sum_probs=60.3 Q ss_pred HHCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCEEEEECHHHHHHH-CCCEEEEE Q ss_conf 406215799999999984366899769980344688879999999999997305939998083798650-17617999 Q gi|255764514|r 427 LASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSKKIQLLAVTHAPQVAAR-ADRHFLVY 503 (554) Q Consensus 427 iaSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~~~Qvi~ITH~pqvAa~-a~~h~~v~ 503 (554) -+|||.+-|+++|..++ ..++.+||||.=+|++-.....+-++|+++++.+=||++||.-..|.. +|+=+.+. T Consensus 130 ~LSgG~kqrv~ia~al~----~~P~lliLDEPt~gLDp~~~~~~~~ll~~l~~~~tii~stH~l~e~e~~~dri~il~ 203 (211) T cd03264 130 SLSGGMRRRVGIAQALV----GDPSILIVDEPTAGLDPEERIRFRNLLSELGEDRIVILSTHIVEDVESLCNQVAVLN 203 (211) T ss_pred HCCHHHHHHHHHHHHHH----CCCCEEEEECCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCHHHHHHHCCEEEEEE T ss_conf 58988999999999982----899999994897678999999999999997299899998998899999699999998 No 178 >cd03224 ABC_TM1139_LivF_branched LivF (TM1139) is part of the LIV-I bacterial ABC-type two-component transport system that imports neutral, branched-chain amino acids. The E. coli branched-chain amino acid transporter comprises a heterodimer of ABC transporters (LivF and LivG), a heterodimer of six-helix TM domains (LivM and LivH), and one of two alternative soluble periplasmic substrate binding proteins (LivK or LivJ). ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. Probab=98.09 E-value=3.2e-05 Score=53.36 Aligned_cols=72 Identities=24% Similarity=0.404 Sum_probs=59.0 Q ss_pred HCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHC-CCEEEEECHHHHH-HHCCCEEEEE Q ss_conf 06215799999999984366899769980344688879999999999997305-9399980837986-5017617999 Q gi|255764514|r 428 ASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSKK-IQLLAVTHAPQVA-ARADRHFLVY 503 (554) Q Consensus 428 aSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~~-~Qvi~ITH~pqvA-a~a~~h~~v~ 503 (554) +|||++=|+++|..++ ..++.++|||.-+|++-.+...+-+.|+++.+. .=||+|||-...| ..+|+=+.+. T Consensus 133 LSgG~~Qrv~iAraL~----~~P~lllLDEPt~gLD~~~~~~i~~~l~~l~~~g~tii~vtHdl~~~~~~~Drv~vl~ 206 (222) T cd03224 133 LSGGEQQMLAIARALM----SRPKLLLLDEPSEGLAPKIVEEIFEAIRELRDEGVTILLVEQNARFALEIADRAYVLE 206 (222) T ss_pred CCHHHHHHHHHHHHHH----CCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCEEEEECCCHHHHHHHCCEEEEEE T ss_conf 8999999999999996----4999999938654799999999999999999569999999085899999699999997 No 179 >cd03232 ABC_PDR_domain2 The pleiotropic drug resistance-like (PDR) family of ATP-binding cassette (ABC) transporters. PDR is a well-described phenomenon occurring in fungi and shares several similarities with processes in bacteria and higher eukaryotes. This PDR subfamily represents domain I of its (ABC-IM)2 organization. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds including sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins. Probab=98.08 E-value=7e-06 Score=57.71 Aligned_cols=33 Identities=36% Similarity=0.634 Sum_probs=29.2 Q ss_pred EEEEEEEEECCCC-EEEEECCCCCCHHHHHHHHH Q ss_conf 7899998873898-18998899978889999999 Q gi|255764514|r 10 VLIESLDIDFSAG-LSILSGDTGSGKSILLDALI 42 (554) Q Consensus 10 ~~i~~~~i~f~~G-l~vItGetGaGKS~ildAl~ 42 (554) ..++++++++.|| +++|.||||||||+++..|. T Consensus 21 ~vL~~is~~i~~Ge~~~llGpnGaGKSTLl~~l~ 54 (192) T cd03232 21 QLLNNISGYVKPGTLTALMGESGAGKTTLLDVLA 54 (192) T ss_pred EEEECCEEEEECCEEEEEECCCCCCHHHHHHHHH T ss_conf 9998838899288399999999998899999983 No 180 >cd03258 ABC_MetN_methionine_transporter MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport. Other members of this system include the MetP permease and the MetQ substrate binding protein. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins. Probab=98.08 E-value=3e-05 Score=53.54 Aligned_cols=73 Identities=23% Similarity=0.321 Sum_probs=60.0 Q ss_pred HCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHH--CCCEEEEECHHHHHH-HCCCEEEEEE Q ss_conf 0621579999999998436689976998034468887999999999999730--593999808379865-0176179999 Q gi|255764514|r 428 ASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSK--KIQLLAVTHAPQVAA-RADRHFLVYK 504 (554) Q Consensus 428 aSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~--~~Qvi~ITH~pqvAa-~a~~h~~v~K 504 (554) +|||++=|+++|-.++. .+..+++||.-++++-.++..|-++|+++-+ ..=+|.|||-+-+|. +||+=+...+ T Consensus 141 LSGGq~QRVaIARAL~~----~P~lllaDEPTs~LD~~~~~~il~ll~~l~~e~g~t~i~vTHDl~~~~~~adrv~vm~~ 216 (233) T cd03258 141 LSGGQKQRVGIARALAN----NPKVLLCDEATSALDPETTQSILALLRDINRELGLTIVLITHEMEVVKRICDRVAVMEK 216 (233) T ss_pred CCHHHHHHHHHHHHHHC----CCCEEEECCCCCCCCHHHHHHHHHHHHHHHHHHCCEEEEECCCHHHHHHHCCEEEEEEC T ss_conf 67788899999999833----99899965976646988999999999999997298999989899999986997999979 No 181 >PRK13546 teichoic acids export protein ATP-binding subunit; Provisional Probab=98.08 E-value=3.1e-05 Score=53.44 Aligned_cols=72 Identities=15% Similarity=0.096 Sum_probs=58.2 Q ss_pred HCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHH-CCCEEEEECHHHHHH-HCCCEEEEE Q ss_conf 0621579999999998436689976998034468887999999999999730-593999808379865-017617999 Q gi|255764514|r 428 ASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSK-KIQLLAVTHAPQVAA-RADRHFLVY 503 (554) Q Consensus 428 aSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~-~~Qvi~ITH~pqvAa-~a~~h~~v~ 503 (554) +|||++-|+++|..++ ..++.+||||.=+|++-.+...+-+.|+++.+ ..=||+|||-...+. .+|+-.... T Consensus 144 LSgGqkqrl~lA~al~----~~P~iLiLDEPts~LD~~~~~~i~~~i~~l~~~g~TiilvSH~l~~v~~lcDri~vl~ 217 (264) T PRK13546 144 YSSGMRAKLGFSINIT----VNPDILVIDEALSVGDQTFAQKCLDKIYEFKEQNKTIFFVSHNLGQVRQFCTKIAWIE 217 (264) T ss_pred CCHHHHHHHHHHHHHH----CCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCEEEEECCCHHHHHHHCCEEEEEE T ss_conf 7999999999999995----6999999959875489999999999999999689899998487899998699999998 No 182 >PRK09536 btuD corrinoid ABC transporter ATPase; Reviewed Probab=98.08 E-value=4.7e-05 Score=52.25 Aligned_cols=39 Identities=26% Similarity=0.444 Sum_probs=32.5 Q ss_pred ECCEEEEEEEEECCCC-EEEEECCCCCCHHHHHHHHHHHH Q ss_conf 4227899998873898-18998899978889999999871 Q gi|255764514|r 7 YNIVLIESLDIDFSAG-LSILSGDTGSGKSILLDALILVT 45 (554) Q Consensus 7 ~Nf~~i~~~~i~f~~G-l~vItGetGaGKS~ildAl~~~l 45 (554) .+...++++++++.+| +++|+||||||||++|.+|+-.+ T Consensus 13 G~~~~L~~Vsl~I~~GEi~gLIGPNGAGKSTLLk~I~Gll 52 (409) T PRK09536 13 GGTTILDGVDLSVREGHLVGVVGPNGAGKTTLLRAMNGLI 52 (409) T ss_pred CCEEEEECEEEEECCCCEEEEECCCCCHHHHHHHHHHCCC T ss_conf 9999892508898899899999998727999999996688 No 183 >cd03290 ABCC_SUR1_N The SUR domain 1. The sulfonylurea receptor SUR is an ATP transporter of the ABCC/MRP family with tandem ATPase binding domains. Unlike other ABC proteins, it has no intrinsic transport function, neither active nor passive, but associates with the potassium channel proteins Kir6.1 or Kir6.2 to form the ATP-sensitive potassium (K(ATP)) channel. Within the channel complex, SUR serves as a regulatory subunit that fine-tunes the gating of Kir6.x in response to alterations in cellular metabolism. It constitutes a major pharmaceutical target as it binds numerous drugs, K(ATP) channel openers and blockers, capable of up- or down-regulating channel activity. Probab=98.08 E-value=2.8e-05 Score=53.70 Aligned_cols=72 Identities=26% Similarity=0.248 Sum_probs=54.5 Q ss_pred HCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHH-H-HHHHHHH-CCCEEEEECHHHHHHHCCCEEEEE Q ss_conf 06215799999999984366899769980344688879999999-9-9999730-593999808379865017617999 Q gi|255764514|r 428 ASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIG-Y-RLKQLSK-KIQLLAVTHAPQVAARADRHFLVY 503 (554) Q Consensus 428 aSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~-~-~l~~ls~-~~Qvi~ITH~pqvAa~a~~h~~v~ 503 (554) +|||++=|+++|-.++ .++|.++|||.=++++-.+...+- + +++.+.+ ..=||+|||-++.+..||+-++.. T Consensus 141 LSGGQ~QRi~iARal~----~~~~illlDEptsaLD~~~~~~i~~~~i~~~~~~~~~TvI~itH~l~~l~~aD~Iivm~ 215 (218) T cd03290 141 LSGGQRQRICVARALY----QNTNIVFLDDPFSALDIHLSDHLMQEGILKFLQDDKRTLVLVTHKLQYLPHADWIIAMK 215 (218) T ss_pred CCHHHHHHHHHHHHHH----HCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCCCEEEEEECCHHHHHHCCEEEEEC T ss_conf 7989999999999984----48999999896557886789999999999997079939999906988998399999985 No 184 >cd03259 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Transporters-like subgroup. This family is comprised of proteins involved in the transport of apparently unrelated solutes and proteins specific for di- and oligosaccharides and polyols. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides and more complex organic molecules. The nucleotide-binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins. Probab=98.07 E-value=2.7e-05 Score=53.84 Aligned_cols=73 Identities=30% Similarity=0.369 Sum_probs=59.5 Q ss_pred HHCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHC--CCEEEEECHHHHH-HHCCCEEEEE Q ss_conf 406215799999999984366899769980344688879999999999997305--9399980837986-5017617999 Q gi|255764514|r 427 LASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSKK--IQLLAVTHAPQVA-ARADRHFLVY 503 (554) Q Consensus 427 iaSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~~--~Qvi~ITH~pqvA-a~a~~h~~v~ 503 (554) -+|||++-|+++|..++ .+++.+++||.=+|++-.+...+-++|+++.+. .=||+|||-+..| ..+|+=+... T Consensus 130 ~LSGG~kQrv~iAraL~----~~P~illlDEPt~gLD~~~~~~i~~li~~l~~~~g~tii~vtHdl~~~~~~~dri~vm~ 205 (213) T cd03259 130 ELSGGQQQRVALARALA----REPSLLLLDEPLSALDAKLREELREELKELQRELGITTIYVTHDQEEALALADRIAVMN 205 (213) T ss_pred CCCHHHHHHHHHHHHHC----CCCCEEEECCCCCCCCHHHHHHHHHHHHHHHHHCCCEEEEECCCHHHHHHHCCEEEEEE T ss_conf 38989999999987622----79999998398643799999999999999999629999999689999999699999998 No 185 >CHL00131 ycf16 sulfate ABC transporter protein; Validated Probab=98.07 E-value=7.8e-06 Score=57.40 Aligned_cols=38 Identities=24% Similarity=0.547 Sum_probs=32.2 Q ss_pred EEECCEEEEEEEEECCCC-EEEEECCCCCCHHHHHHHHH Q ss_conf 994227899998873898-18998899978889999999 Q gi|255764514|r 5 SIYNIVLIESLDIDFSAG-LSILSGDTGSGKSILLDALI 42 (554) Q Consensus 5 ~i~Nf~~i~~~~i~f~~G-l~vItGetGaGKS~ildAl~ 42 (554) +..+....+++++++.+| +.+|+||||||||+++.+|+ T Consensus 15 ~y~~~~vL~~isl~i~~Gei~aiiG~nGsGKSTL~~~i~ 53 (252) T CHL00131 15 TVNETEILKGINLSINAGEIHAIMGPNGSGKSTLSKVIA 53 (252) T ss_pred EECCEEEEECCEEEECCCCEEEEECCCCCCHHHHHHHHC T ss_conf 999999885617788799899999999999999999972 No 186 >PRK13636 cbiO cobalt transporter ATP-binding subunit; Provisional Probab=98.07 E-value=4.3e-05 Score=52.51 Aligned_cols=73 Identities=23% Similarity=0.316 Sum_probs=59.7 Q ss_pred HCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCC--CEEEEECHHHHHH-HCCCEEEEEE Q ss_conf 062157999999999843668997699803446888799999999999973059--3999808379865-0176179999 Q gi|255764514|r 428 ASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSKKI--QLLAVTHAPQVAA-RADRHFLVYK 504 (554) Q Consensus 428 aSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~~~--Qvi~ITH~pqvAa-~a~~h~~v~K 504 (554) +|||++=|+++|-.++. .++.+||||.=+|++-.....|-+.|+++.+.. =||+|||-...++ ++|+=++..+ T Consensus 142 LSGGqkqRvaIA~aLa~----~P~iLlLDEPTagLDp~~~~~i~~ll~~l~~e~g~TiilvtHd~~~v~~~aDrvivl~~ 217 (285) T PRK13636 142 LSFGQKKRVAIAGVLVM----EPKVLVLDEPTAGLDPMGVSEIMKLLVEMQKELGLTIIIATHDIDIVPLYCDNVFVMKE 217 (285) T ss_pred CCHHHHHHHHHHHHHHC----CCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHCCCEEEEECCCHHHHHHHCCEEEEEEC T ss_conf 99999999999999974----99899997875559999999999999999984498999994889999996999999989 No 187 >cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos). The Carb_Monos family is involved in the uptake of monosaccharides, such as pentoses (such as xylose, arabinose, and ribose) and hexoses (such as xylose, arabinose, and ribose), that cannot be broken down to simple sugars by hydrolysis. Pentoses include xylose, arabinose, and ribose. Important hexoses include glucose, galactose, and fructose. In members of the Carb_monos family, the single hydrophobic gene product forms a homodimer while the ABC protein represents a fusion of two nucleotide-binding domains. However, it is assumed that two copies of the ABC domains are present in the assembled transporter. Probab=98.07 E-value=3.5e-05 Score=53.11 Aligned_cols=72 Identities=19% Similarity=0.239 Sum_probs=58.4 Q ss_pred HCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHC-CCEEEEECHHH-HHHHCCCEEEEE Q ss_conf 06215799999999984366899769980344688879999999999997305-93999808379-865017617999 Q gi|255764514|r 428 ASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSKK-IQLLAVTHAPQ-VAARADRHFLVY 503 (554) Q Consensus 428 aSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~~-~Qvi~ITH~pq-vAa~a~~h~~v~ 503 (554) +|||++=|+++|..++ ..++.+||||.=+|++-.+...+-+.++++.+. .=||+|||-.. +...+|+-+... T Consensus 83 LSgG~~Qrv~iaral~----~~p~llilDEPt~gLD~~~~~~i~~~l~~l~~~G~til~vtH~l~~~~~~~Drv~vl~ 156 (163) T cd03216 83 LSVGERQMVEIARALA----RNARLLILDEPTAALTPAEVERLFKVIRRLRAQGVAVIFISHRLDEVFEIADRVTVLR 156 (163) T ss_pred CCHHHHHHHHHHHHHH----HCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCEEEEEECCHHHHHHHCCEEEEEC T ss_conf 9989999999999997----2999999909755799999999999999998789899999384999998699999990 No 188 >PRK13637 cbiO cobalt transporter ATP-binding subunit; Provisional Probab=98.07 E-value=3.7e-05 Score=52.93 Aligned_cols=73 Identities=29% Similarity=0.404 Sum_probs=60.9 Q ss_pred HCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHC--CCEEEEECHHHH-HHHCCCEEEEEE Q ss_conf 06215799999999984366899769980344688879999999999997305--939998083798-650176179999 Q gi|255764514|r 428 ASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSKK--IQLLAVTHAPQV-AARADRHFLVYK 504 (554) Q Consensus 428 aSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~~--~Qvi~ITH~pqv-Aa~a~~h~~v~K 504 (554) +|||++=|+++|-.++. .++.++|||.=+|++-.+...+-+.|++|.+. .-||+|||-... +..||+=++..+ T Consensus 145 LSGGqkQRvaiA~aL~~----~P~iLllDEPTs~LDp~~~~~i~~~l~~L~~e~g~Tvi~vTHdl~~v~~~aDRvivl~~ 220 (287) T PRK13637 145 LSGGQKRRVAIAGVVAM----EPKVLILDEPTAGLDPKGRDDILEKIKALHKEYNMTIILVSHSMEDVAKIADRIIVMNK 220 (287) T ss_pred CCHHHHHHHHHHHHHHC----CCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHCCCEEEEECCCHHHHHHHCCEEEEEEC T ss_conf 99889999999999983----99999983886648999999999999999985098999995799999996999999989 No 189 >PRK13547 hmuV hemin importer ATP-binding subunit; Provisional Probab=98.07 E-value=8.9e-06 Score=57.04 Aligned_cols=39 Identities=28% Similarity=0.446 Sum_probs=32.4 Q ss_pred EECCEEEEEEEEECCCC-EEEEECCCCCCHHHHHHHHHHH Q ss_conf 94227899998873898-1899889997888999999987 Q gi|255764514|r 6 IYNIVLIESLDIDFSAG-LSILSGDTGSGKSILLDALILV 44 (554) Q Consensus 6 i~Nf~~i~~~~i~f~~G-l~vItGetGaGKS~ildAl~~~ 44 (554) ..+...++++++++.+| +++|.||||||||+++.+|.-. T Consensus 11 ~~~~~vL~~vsl~i~~Ge~~aliG~nGaGKSTLl~~i~G~ 50 (273) T PRK13547 11 RRHRAILRDLSLRIEPGRVTALLGRNGAGKSTLLKVLAGE 50 (273) T ss_pred ECCEEEEECEEEEECCCCEEEEECCCCCHHHHHHHHHHCC T ss_conf 9999999760889989989999999997699999999567 No 190 >TIGR03411 urea_trans_UrtD urea ABC transporter, ATP-binding protein UrtD. Members of this protein family are ABC transporter ATP-binding subunits associated with urea transport and metabolism. This protein is found in a conserved five-gene transport operon typically found adjacent to urease genes. It was shown in Cyanobacteria that disruption leads to the loss of high-affinity urea transport activity. Probab=98.06 E-value=5e-05 Score=52.09 Aligned_cols=73 Identities=21% Similarity=0.259 Sum_probs=60.0 Q ss_pred HHCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCEEEEECHHHHHH-HCCCEEEEE Q ss_conf 40621579999999998436689976998034468887999999999999730593999808379865-017617999 Q gi|255764514|r 427 LASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSKKIQLLAVTHAPQVAA-RADRHFLVY 503 (554) Q Consensus 427 iaSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~~~Qvi~ITH~pqvAa-~a~~h~~v~ 503 (554) -+|||++=|+++|..++ ..++.++|||.-+|++-.....+.+.|+++.+..-||+|||-...+. .+|+=++.. T Consensus 143 ~LSgGqkqrv~iA~aL~----~~P~lllLDEPt~gLD~~~~~~i~~ll~~l~~~~tvi~isHdl~~~~~~~drv~vl~ 216 (242) T TIGR03411 143 LLSHGQKQWLEIGMLLM----QDPKLLLLDEPVAGMTDEETEKTAELLKSLAGKHSVVVVEHDMEFVRSIADKVTVLH 216 (242) T ss_pred HCCHHHHHHHHHHHHHH----HCCCEEEEECCCCCCCHHHHHHHHHHHHHHHCCCEEEEEECCHHHHHHHCCEEEEEE T ss_conf 59978999999999997----389989991864369989999999999998579979999785999999799999997 No 191 >PRK13631 cbiO cobalt transporter ATP-binding subunit; Provisional Probab=98.06 E-value=3.5e-05 Score=53.14 Aligned_cols=73 Identities=21% Similarity=0.276 Sum_probs=59.9 Q ss_pred HCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHH-CCCEEEEECHHHHH-HHCCCEEEEEE Q ss_conf 0621579999999998436689976998034468887999999999999730-59399980837986-50176179999 Q gi|255764514|r 428 ASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSK-KIQLLAVTHAPQVA-ARADRHFLVYK 504 (554) Q Consensus 428 aSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~-~~Qvi~ITH~pqvA-a~a~~h~~v~K 504 (554) +|||++=|+++|-.++. .++.+||||-=+|++-.....|-++++++.+ ..=||+|||-...| ..||+=++..+ T Consensus 177 LSGGqkQRVaIA~aLa~----~P~iLilDEPTagLDp~~~~~i~~li~~l~~~g~TiilvTHdm~~v~~~aDrviVm~~ 251 (320) T PRK13631 177 LSGGQKRRVAIAGILAI----QPEILIFDEPTAGLDPKGEHEMMQLILDAKANNKTVFVITHTMEHVLEVADEVIVMDK 251 (320) T ss_pred CCHHHHHHHHHHHHHHC----CCCEEEECCCCCCCCHHHHHHHHHHHHHHHHCCCEEEEECCCHHHHHHHCCEEEEEEC T ss_conf 99999999999999723----9999997587555998999999999999996299999994789999997999999989 No 192 >PRK10253 iron-enterobactin transporter ATP-binding protein; Provisional Probab=98.06 E-value=8.9e-06 Score=57.03 Aligned_cols=38 Identities=29% Similarity=0.534 Sum_probs=32.3 Q ss_pred CCEEEEEEEEECCCC-EEEEECCCCCCHHHHHHHHHHHH Q ss_conf 227899998873898-18998899978889999999871 Q gi|255764514|r 8 NIVLIESLDIDFSAG-LSILSGDTGSGKSILLDALILVT 45 (554) Q Consensus 8 Nf~~i~~~~i~f~~G-l~vItGetGaGKS~ildAl~~~l 45 (554) +...++++++++.+| +++|.||||||||+++.+|+-.+ T Consensus 19 ~~~~l~~isl~I~~Ge~~~iiGpNGaGKSTLlk~i~Gll 57 (265) T PRK10253 19 KYTVAENLTVEIPDGHFTAIIGPNGCGKSTLLRTLSRLM 57 (265) T ss_pred CEEEEEEEEEEECCCCEEEEECCCCCHHHHHHHHHHCCC T ss_conf 999984028898599799999998839999999997498 No 193 >TIGR02211 LolD_lipo_ex lipoprotein releasing system, ATP-binding protein; InterPro: IPR011924 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems. ABC transporters are minimally constituted of two conserved regions: a highly conserved ATP binding cassette (ABC) and a less conserved transmembrane domain (TMD). These regions can be found on the same protein or on two different ones. Most ABC transporters function as a dimer and therefore are constituted of four domains, two ABC modules and two TMDs. ABC transporters are involved in the export or import of a wide variety of substrates ranging from small ions to macromolecules. The major function of ABC import systems is to provide essential nutrients to bacteria. They are found only in prokaryotes and their four constitutive domains are usually encoded by independent polypeptides (two ABC proteins and two TMD proteins). Prokaryotic importers require additional extracytoplasmic binding proteins (one or more per systems) for function. In contrast, export systems are involved in the extrusion of noxious substances, the export of extracellular toxins and the targeting of membrane components. They are found in all living organisms and in general the TMD is fused to the ABC module in a variety of combinations. Some eukaryotic exporters encode the four domains on the same polypeptide chain . The ABC module (approximately two hundred amino acid residues) is known to bind and hydrolyze ATP, thereby coupling transport to ATP hydrolysis in a large number of biological processes. The cassette is duplicated in several subfamilies. Its primary sequence is highly conserved, displaying a typical phosphate-binding loop: Walker A, and a magnesium binding site: Walker B. Besides these two regions, three other conserved motifs are present in the ABC cassette: the switch region which contains a histidine loop, postulated to polarize the attaching water molecule for hydrolysis, the signature conserved motif (LSGGQ) specific to the ABC transporter, and the Q-motif (between Walker A and the signature), which interacts with the gamma phosphate through a water bond. The Walker A, Walker B, Q-loop and switch region form the nucleotide binding site , , . The 3D structure of a monomeric ABC module adopts a stubby L-shape with two distinct arms. ArmI (mainly beta-strand) contains Walker A and Walker B. The important residues for ATP hydrolysis and/or binding are located in the P-loop. The ATP-binding pocket is located at the extremity of armI. The perpendicular armII contains mostly the alpha helical subdomain with the signature motif. It only seems to be required for structural integrity of the ABC module. ArmII is in direct contact with the TMD. The hinge between armI and armII contains both the histidine loop and the Q-loop, making contact with the gamma phosphate of the ATP molecule. ATP hydrolysis leads to a conformational change that could facilitate ADP release. In the dimer the two ABC cassettes contact each other through hydrophobic interactions at the antiparallel beta-sheet of armI by a two-fold axis , , , , , . Proteins known to belong to this family are classified in several functional subfamilies depending on the substrate used (for further information see http://www.tcdb.org/tcdb/index.php?tc=3.A.1). This entry represents LolD, a member of the ABC transporter family. LolD is involved in localization of lipoproteins in some bacteria. It works with a transmembrane protein LolC, which in some species is a paralogous pair LolC and LolE. Depending on the residue immediately following the modified N-terminal Cys residue, the nascent lipoprotein may be carried further by LolA and LolB to the outer membrane, or remain at the inner membrane. Excluded from this entry are homologs from the archaeal genus Methanosarcina .; GO: 0005524 ATP binding, 0006810 transport, 0016020 membrane. Probab=98.06 E-value=2.2e-05 Score=54.38 Aligned_cols=70 Identities=31% Similarity=0.438 Sum_probs=58.6 Q ss_pred CCHHHHHHHHHHHHHHCCCCCCCEEEE-ECCCCCCCHHHHHHHHHHHHHHHH--CCCEEEEECHHHHHHHCCCEEEEE Q ss_conf 621579999999998436689976998-034468887999999999999730--593999808379865017617999 Q gi|255764514|r 429 SGGELSRFLLALKIVLVDQGSIPTLVF-DEVDSGIGGAVADAIGYRLKQLSK--KIQLLAVTHAPQVAARADRHFLVY 503 (554) Q Consensus 429 SGGE~Sr~~LAl~~~~~~~~~~p~~if-DEiDagi~G~~a~~v~~~l~~ls~--~~Qvi~ITH~pqvAa~a~~h~~v~ 503 (554) ||||.=|+|.|=.+| +-|-||| ||.=-|++-.||..|=++|.+|-+ ++=||||||=++.|.+.+.-+.++ T Consensus 143 SGGERQRvAIARALv-----N~P~lvlADEPTGNLD~~~a~~iF~L~~eLN~~~~TsflvVTHD~~LA~k~~r~L~m~ 215 (221) T TIGR02211 143 SGGERQRVAIARALV-----NQPSLVLADEPTGNLDNNNAKSIFELMLELNRELNTSFLVVTHDLELAKKLDRVLEMK 215 (221) T ss_pred CCCHHHHHHHHHHHH-----CCCCEEECCCCCCHHHHHHHHHHHHHHHHHHHHCCCEEEEEECCHHHHHCCCEEEEEE T ss_conf 563379999999861-----8976586129885323777999999999988653916999834757873021026630 No 194 >PRK11124 artP arginine transporter ATP-binding subunit; Provisional Probab=98.06 E-value=3e-05 Score=53.59 Aligned_cols=73 Identities=26% Similarity=0.367 Sum_probs=60.4 Q ss_pred HCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHC-CCEEEEECHHHHHH-HCCCEEEEEE Q ss_conf 06215799999999984366899769980344688879999999999997305-93999808379865-0176179999 Q gi|255764514|r 428 ASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSKK-IQLLAVTHAPQVAA-RADRHFLVYK 504 (554) Q Consensus 428 aSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~~-~Qvi~ITH~pqvAa-~a~~h~~v~K 504 (554) +|||++=|+++|-.++ ..++.++|||.=+|++-.+...+-+.|+++.+. .=+|+|||-...|. .||+-++..+ T Consensus 142 LSGGq~QRvaiAraL~----~~P~iLllDEPTs~LD~~~~~~i~~ll~~l~~~g~tii~vtHdl~~~~~~adri~vl~~ 216 (242) T PRK11124 142 LSGGQQQRVAIARALM----MEPQVLLFDEPTAALDPEITAQIVSIIRELAETGITQVIVTHEVEVARKTASRVVYMEN 216 (242) T ss_pred CCHHHHHHHHHHHHHC----CCCCEEEECCCCCCCCHHHHHHHHHHHHHHHHCCCEEEEECCCHHHHHHHCCEEEEEEC T ss_conf 7999989999876433----79979997688654899999999999999984299899988899999996999999979 No 195 >cd03297 ABC_ModC_molybdenum_transporter ModC is an ABC-type transporter and the ATPase component of a molybdate transport system that also includes the periplasmic binding protein ModA and the membrane protein ModB. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins. Probab=98.06 E-value=3.5e-05 Score=53.14 Aligned_cols=72 Identities=32% Similarity=0.336 Sum_probs=59.7 Q ss_pred HCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCC--CEEEEECHHHHHHH-CCCEEEEE Q ss_conf 062157999999999843668997699803446888799999999999973059--39998083798650-17617999 Q gi|255764514|r 428 ASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSKKI--QLLAVTHAPQVAAR-ADRHFLVY 503 (554) Q Consensus 428 aSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~~~--Qvi~ITH~pqvAa~-a~~h~~v~ 503 (554) +|||++-|+++|=.++ ..+..+++||.=++++-.+...+-+.|+++-+.+ =+|+|||-|..|.. ||+=+.+. T Consensus 132 LSGGq~QRVaiARAL~----~~P~llLlDEP~saLD~~~~~~i~~~l~~l~~~~~~t~i~VTHd~~e~~~ladrv~vm~ 206 (214) T cd03297 132 LSGGEKQRVALARALA----AQPELLLLDEPFSALDRALRLQLLPELKQIKKNLNIPVIFVTHDLSEAEYLADRIVVME 206 (214) T ss_pred CCHHHHHHHHHHHHHH----CCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHHCCEEEEECCCHHHHHHHCCEEEEEE T ss_conf 9929999999999987----19999998088766699999999999999999859989999899999999699999998 No 196 >cd03234 ABCG_White The White subfamily represents ABC transporters homologous to the Drosophila white gene, which acts as a dimeric importer for eye pigment precursors. The eye pigmentation of Drosophila is developed from the synthesis and deposition in the cells of red pigments, which are synthesized from guanine, and brown pigments, which are synthesized from tryptophan. The pigment precursors are encoded by the white, brown, and scarlet genes, respectively. Evidence from genetic and biochemical studies suggest that the White and Brown proteins function as heterodimers to import guanine, while the White and Scarlet proteins function to import tryptophan. However, a recent study also suggests that White may be involved in the transport of a metabolite, such as 3-hydroxykynurenine, across intracellular membranes. Mammalian ABC transporters belonging to the White subfamily (ABCG1, ABCG5, and ABCG8) have been shown to be involved in the regulation of lipid-trafficking mechanisms in Probab=98.06 E-value=7.7e-06 Score=57.43 Aligned_cols=40 Identities=30% Similarity=0.516 Sum_probs=33.8 Q ss_pred EEEECC----EEEEEEEEECCCC-EEEEECCCCCCHHHHHHHHHH Q ss_conf 999422----7899998873898-189988999788899999998 Q gi|255764514|r 4 LSIYNI----VLIESLDIDFSAG-LSILSGDTGSGKSILLDALIL 43 (554) Q Consensus 4 L~i~Nf----~~i~~~~i~f~~G-l~vItGetGaGKS~ildAl~~ 43 (554) ..++++ ..++++++++.+| +++|.||||||||+++.+|.- T Consensus 11 ~~~k~~~~~~~vL~~vs~~i~~Ge~~~ilGpnGsGKSTLl~~i~G 55 (226) T cd03234 11 LKAKNWNKYARILNDVSLHVESGQVMAILGSSGSGKTTLLDAISG 55 (226) T ss_pred EEEECCCCCEEEEECCEEEEECCCEEEEECCCCCHHHHHHHHHHC T ss_conf 898807998899889778991880999998999609999999967 No 197 >PRK11701 phnK phosphonates transport ATP-binding protein; Provisional Probab=98.06 E-value=9.8e-06 Score=56.76 Aligned_cols=74 Identities=27% Similarity=0.306 Sum_probs=59.6 Q ss_pred HCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHH--CCCEEEEECHHHHHHHCCCEEEEEEE Q ss_conf 0621579999999998436689976998034468887999999999999730--59399980837986501761799996 Q gi|255764514|r 428 ASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSK--KIQLLAVTHAPQVAARADRHFLVYKT 505 (554) Q Consensus 428 aSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~--~~Qvi~ITH~pqvAa~a~~h~~v~K~ 505 (554) +|||++=|+++|-.++ ..++.+++||.=+|++-.+...+-+.|+++.+ ..=||+|||-..+|..--.++.|-+. T Consensus 152 LSGG~~QRv~iAraL~----~~P~llllDEPtsgLD~~~~~~i~~~l~~l~~~~g~til~vtHdl~~~~~laDri~vl~~ 227 (258) T PRK11701 152 FSGGMQQRLQIARNLV----THPRLVFMDEPTGGLDVSVQARLLDLLRGLVVELGLAVVIVTHDLAVARLLAHRLLVMKQ 227 (258) T ss_pred CCHHHHHHHHHHHHHH----CCCCEEEECCCCCCCCHHHHHHHHHHHHHHHHHHCCEEEEECCCHHHHHHHCCEEEEEEC T ss_conf 4789999999999986----499999985986568999999999999999996098999993788999997999999989 No 198 >PRK13542 consensus Probab=98.05 E-value=2.6e-05 Score=54.00 Aligned_cols=67 Identities=22% Similarity=0.170 Sum_probs=53.3 Q ss_pred HHCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHH-CCCEEEEECH--HHHHHHCC Q ss_conf 40621579999999998436689976998034468887999999999999730-5939998083--79865017 Q gi|255764514|r 427 LASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSK-KIQLLAVTHA--PQVAARAD 497 (554) Q Consensus 427 iaSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~-~~Qvi~ITH~--pqvAa~a~ 497 (554) -+|||++-|+++|-.++ .+.+.+||||.=+|++-.....+-++++++.+ ..-||++||. |..++.+| T Consensus 147 ~LSgGqrqRv~lA~al~----~~p~illLDEPtagLD~~~~~~l~~~i~~~~~~g~tvIi~tH~l~~~~~~~~d 216 (224) T PRK13542 147 TLSQGQRRRVALARLAL----TPRALWLLDEPLTSLDDASAACFHTLLDEHLRRGGMAVVATHQLLPGEGAVLD 216 (224) T ss_pred HCCHHHHHHHHHHHHHH----CCCCEEEECCCCCCCCHHHHHHHHHHHHHHHHCCCEEEEEECCCCHHHHHHHH T ss_conf 49999999999999980----79988997385354899999999999999996899899995887488888877 No 199 >COG1121 ZnuC ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism] Probab=98.05 E-value=5.6e-06 Score=58.35 Aligned_cols=35 Identities=31% Similarity=0.625 Sum_probs=28.9 Q ss_pred EEEEEEEECCCC-EEEEECCCCCCHHHHHHHHHHHH Q ss_conf 899998873898-18998899978889999999871 Q gi|255764514|r 11 LIESLDIDFSAG-LSILSGDTGSGKSILLDALILVT 45 (554) Q Consensus 11 ~i~~~~i~f~~G-l~vItGetGaGKS~ildAl~~~l 45 (554) .++++++.+.+| |+.|+||||||||+|+.+|.=++ T Consensus 19 vl~~i~l~v~~G~~~~iiGPNGaGKSTLlK~iLGll 54 (254) T COG1121 19 VLEDISLSVEKGEITALIGPNGAGKSTLLKAILGLL 54 (254) T ss_pred EEECCEEEECCCCEEEEECCCCCCHHHHHHHHHCCC T ss_conf 041538997489689999998888899999996787 No 200 >PRK11614 livF leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Probab=98.05 E-value=5.5e-05 Score=51.80 Aligned_cols=73 Identities=21% Similarity=0.339 Sum_probs=59.5 Q ss_pred HCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHC-CCEEEEECHHH-HHHHCCCEEEEEE Q ss_conf 06215799999999984366899769980344688879999999999997305-93999808379-8650176179999 Q gi|255764514|r 428 ASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSKK-IQLLAVTHAPQ-VAARADRHFLVYK 504 (554) Q Consensus 428 aSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~~-~Qvi~ITH~pq-vAa~a~~h~~v~K 504 (554) +|||++-|+++|..++ ..++.+||||.-+|++-.+...+-+.|+++.+. .=||+|||-.. +...||+=+.... T Consensus 138 LSgG~~Qrv~iAraL~----~~P~lLlLDEPt~gLD~~~~~~i~~~l~~l~~~g~tii~vsH~l~~~~~~aDrv~vl~~ 212 (237) T PRK11614 138 MSGGEQQMLAIGRALM----SQPRLLLLDEPSLGLAPIIIQQIFDTIEQLREQGMTIFLVEQNANQALKLADRGYVLEN 212 (237) T ss_pred CCHHHHHHHHHHHHHH----CCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCEEEEEECCHHHHHHHCCEEEEEEC T ss_conf 8998859999999985----69999999597557999999999999999996799999994758999996999999979 No 201 >cd03236 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 of RNase L inhibitor. The ABC ATPase, RNase L inhibitor (RLI), is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids. RLI s are not transport proteins and thus cluster with a group of soluble proteins that lack the transmembrane components commonly found in other members of the family. Structurally, RLIs have an N-terminal Fe-S domain and two nucleotide binding domains which are arranged to form two composite active sites in their interface cleft. RLI is one of the most conserved enzymes between archaea and eukaryotes with a sequence identity more than 48%. The high degree of evolutionary conservation suggests that RLI performs a central role in archaeal and eukaryotic physiology. Probab=98.05 E-value=4.3e-05 Score=52.51 Aligned_cols=72 Identities=25% Similarity=0.274 Sum_probs=58.4 Q ss_pred HCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHH-CCCEEEEECHHHHHH-HCCCEEEEE Q ss_conf 0621579999999998436689976998034468887999999999999730-593999808379865-017617999 Q gi|255764514|r 428 ASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSK-KIQLLAVTHAPQVAA-RADRHFLVY 503 (554) Q Consensus 428 aSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~-~~Qvi~ITH~pqvAa-~a~~h~~v~ 503 (554) +||||+=|+++|-.++ ..++.++|||.=+|++-.....|.++|++|.+ ..=||+|||--.+|. .+|+=.+.+ T Consensus 140 LSGGq~QRvaIAraL~----~~P~iLlLDEPTs~LD~~~~~~v~~li~~L~~~G~Tvi~vtHDl~~~~~laDrI~Vm~ 213 (255) T cd03236 140 LSGGELQRVAIAAALA----RDADFYFFDEPSSYLDIKQRLNAARLIRELAEDDNYVLVVEHDLAVLDYLSDYIHCLY 213 (255) T ss_pred CCHHHHHHHHHHHHHC----CCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCEEEEECCCHHHHHHHCCEEEEEE T ss_conf 8999999999999736----8999999979876589999999999999999789999999078999998699899981 No 202 >cd03218 ABC_YhbG The ABC transporters belonging to the YhbG family are similar to members of the Mj1267_LivG family, which is involved in the transport of branched-chain amino acids. The genes yhbG and yhbN are located in a single operon and may function together in cell envelope during biogenesis. YhbG is the putative ATP-binding cassette component and YhbN is the putative periplasmic-binding protein. Depletion of each gene product leads to growth arrest, irreversible cell damage and loss of viability in E. coli. The YhbG homolog (NtrA) is essential in Rhizobium meliloti, a symbiotic nitrogen-fixing bacterium. Probab=98.04 E-value=4.8e-05 Score=52.21 Aligned_cols=74 Identities=24% Similarity=0.343 Sum_probs=60.1 Q ss_pred HHCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCC-CEEEEECHHH-HHHHCCCEEEEEE Q ss_conf 4062157999999999843668997699803446888799999999999973059-3999808379-8650176179999 Q gi|255764514|r 427 LASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSKKI-QLLAVTHAPQ-VAARADRHFLVYK 504 (554) Q Consensus 427 iaSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~~~-Qvi~ITH~pq-vAa~a~~h~~v~K 504 (554) -+|||++=|+.+|..++ ..++.++|||.-+|++-.....+-+.|+++.+.. =||+|||-.. +...+|+-+.+.+ T Consensus 133 ~LSgG~~qrv~iAraL~----~~P~illlDEPt~GLDp~~~~~i~~~i~~l~~~g~tili~tH~l~~~~~~~drv~vl~~ 208 (232) T cd03218 133 SLSGGERRRVEIARALA----TNPKFLLLDEPFAGVDPIAVQDIQKIIKILKDRGIGVLITDHNVRETLSITDRAYIIYE 208 (232) T ss_pred HCCHHHHHHHHHHHHHH----CCCCEEEECCCCCCCCHHHHHHHHHHHHHHHHCCCEEEEEECCHHHHHHHCCEEEEEEC T ss_conf 59999999999999996----69999998898568899999999999999995899999992839999986999999979 No 203 >PRK10619 histidine/lysine/arginine/ornithine transporter subunit; Provisional Probab=98.04 E-value=5.8e-05 Score=51.65 Aligned_cols=74 Identities=23% Similarity=0.364 Sum_probs=59.6 Q ss_pred HCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHC-CCEEEEECHHHHHHHCCCEEEEEEE Q ss_conf 06215799999999984366899769980344688879999999999997305-9399980837986501761799996 Q gi|255764514|r 428 ASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSKK-IQLLAVTHAPQVAARADRHFLVYKT 505 (554) Q Consensus 428 aSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~~-~Qvi~ITH~pqvAa~a~~h~~v~K~ 505 (554) +||||+=|+++|-.++. .+..++|||.=+|++-.+...|-+.|+++.+. .=||+|||-..+|..--.+..|-+. T Consensus 153 LSGGq~QRv~IAraL~~----~P~lLllDEPts~LD~~~~~~i~~ll~~l~~~g~tii~vtHdl~~~~~~adri~vl~~ 227 (257) T PRK10619 153 LSGGQQQRVSIARALAM----EPEVLLFDEPTSALDPELVGEVLRIMQQLAEEGKTMVVVTHEMGFARHVSSHVIFLHQ 227 (257) T ss_pred CCHHHHHHHHHHHHHHC----CCCEEEECCCCCCCCHHHHHHHHHHHHHHHHCCCEEEEECCCHHHHHHHCCEEEEEEC T ss_conf 89999999999999863----9989997688665898999999999999997599999994899999986999999989 No 204 >PRK10636 putative ABC transporter ATP-binding protein; Provisional Probab=98.04 E-value=1.3e-05 Score=55.95 Aligned_cols=77 Identities=21% Similarity=0.260 Sum_probs=58.4 Q ss_pred CCHHHHHHCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCEEEEECHHHHHHHCCCEE Q ss_conf 31135440621579999999998436689976998034468887999999999999730593999808379865017617 Q gi|255764514|r 421 PGPLMKLASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSKKIQLLAVTHAPQVAARADRHF 500 (554) Q Consensus 421 ~~pl~kiaSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~~~Qvi~ITH~pqvAa~a~~h~ 500 (554) .+|++ .+||||++|++||..++ .++.++|+||.--.++=.+.+.+.+.|..... =||+|||=-.--..--.++ T Consensus 425 ~~~v~-~LSGGEk~Rl~LA~~l~----~~pnlLiLDEPTNhLDi~s~e~Le~aL~~y~G--tvl~VSHDr~fl~~~~~~~ 497 (638) T PRK10636 425 TEETR-RFSGGEKARLVLALIVW----QRPNLLLLDEPTNHLDLDMRQALTEALIDFEG--ALVVVSHDRHLLRSTTDDL 497 (638) T ss_pred CCCCC-CCCHHHHHHHHHHHHHH----CCCCEEEEECCCCCCCHHHHHHHHHHHHHCCC--EEEEEECCHHHHHHHCCEE T ss_conf 39113-39999999999999982----59988998588766888999999999984898--3999978999999752789 Q ss_pred EEEE Q ss_conf 9999 Q gi|255764514|r 501 LVYK 504 (554) Q Consensus 501 ~v~K 504 (554) .+.. T Consensus 498 ~~~~ 501 (638) T PRK10636 498 YLVH 501 (638) T ss_pred EEEE T ss_conf 9996 No 205 >cd03264 ABC_drug_resistance_like ABC-type multidrug transport system, ATPase component. The biological function of this family is not well characterized, but display ABC domains similar to members of ABCA subfamily. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins. Probab=98.04 E-value=7.2e-06 Score=57.62 Aligned_cols=38 Identities=21% Similarity=0.368 Sum_probs=32.5 Q ss_pred EECCEEEEEEEEECCCCEEEEECCCCCCHHHHHHHHHH Q ss_conf 94227899998873898189988999788899999998 Q gi|255764514|r 6 IYNIVLIESLDIDFSAGLSILSGDTGSGKSILLDALIL 43 (554) Q Consensus 6 i~Nf~~i~~~~i~f~~Gl~vItGetGaGKS~ildAl~~ 43 (554) ..+....+++++++.+|+++|.||||||||+++..|.= T Consensus 10 y~~~~al~~vs~~i~~Gi~gllGpNGAGKSTll~~i~G 47 (211) T cd03264 10 YGKKRALDGVSLTLGPGMYGLLGPNGAGKTTLMRILAT 47 (211) T ss_pred ECCEEEECCCEEEECCCEEEEECCCCCHHHHHHHHHHC T ss_conf 99989973714688897599999998239999999975 No 206 >PRK13538 cytochrome c biogenesis protein CcmA; Provisional Probab=98.04 E-value=1.2e-05 Score=56.23 Aligned_cols=39 Identities=33% Similarity=0.522 Sum_probs=32.4 Q ss_pred ECCEEEEEEEEECCCC-EEEEECCCCCCHHHHHHHHHHHH Q ss_conf 4227899998873898-18998899978889999999871 Q gi|255764514|r 7 YNIVLIESLDIDFSAG-LSILSGDTGSGKSILLDALILVT 45 (554) Q Consensus 7 ~Nf~~i~~~~i~f~~G-l~vItGetGaGKS~ildAl~~~l 45 (554) .+..+++++++++.+| +.+|+||||||||+++..|+-.+ T Consensus 12 g~~~vl~~vs~~i~~Ge~~~l~G~NGaGKSTLl~~l~Gl~ 51 (204) T PRK13538 12 DERILFEGLSFTLNAGELVQIEGPNGAGKTSLLRILAGLA 51 (204) T ss_pred CCEEEEECEEEEECCCCEEEEECCCCCCHHHHHHHHHCCC T ss_conf 9999980517798799899999999985999999997688 No 207 >cd03235 ABC_Metallic_Cations ABC component of the metal-type transporters. This family includes transporters involved in the uptake of various metallic cations such as iron, manganese, and zinc. The ATPases of this group of transporters are very similar to members of iron-siderophore uptake family suggesting that they share a common ancestor. The best characterized metal-type ABC transporters are the YfeABCD system of Y. pestis, the SitABCD system of Salmonella enterica serovar Typhimurium, and the SitABCD transporter of Shigella flexneri. Moreover other uncharacterized homologs of these metal-type transporters are mainly found in pathogens like Haemophilus or enteroinvasive E. coli isolates. Probab=98.03 E-value=1.3e-05 Score=55.85 Aligned_cols=42 Identities=26% Similarity=0.449 Sum_probs=35.4 Q ss_pred EEEECCEEEEEEEEECCCC-EEEEECCCCCCHHHHHHHHHHHH Q ss_conf 9994227899998873898-18998899978889999999871 Q gi|255764514|r 4 LSIYNIVLIESLDIDFSAG-LSILSGDTGSGKSILLDALILVT 45 (554) Q Consensus 4 L~i~Nf~~i~~~~i~f~~G-l~vItGetGaGKS~ildAl~~~l 45 (554) .+..|...++++++++.+| +.+|.||||||||+++..|+-.+ T Consensus 7 ~~yg~~~~L~~is~~i~~Ge~~~liGpNGaGKSTllk~i~Gl~ 49 (213) T cd03235 7 VSYGGHPVLEDVSFEVKPGEFLAIVGPNGAGKSTLLKAILGLL 49 (213) T ss_pred EEECCEEEEEEEEEEECCCCEEEEECCCCCCHHHHHHHHHCCC T ss_conf 9999999885027898599899999999986999999997687 No 208 >cd03293 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins. Probab=98.03 E-value=4.6e-05 Score=52.30 Aligned_cols=73 Identities=26% Similarity=0.248 Sum_probs=59.4 Q ss_pred HCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHH--CCCEEEEECHHHHH-HHCCCEEEEEE Q ss_conf 0621579999999998436689976998034468887999999999999730--59399980837986-50176179999 Q gi|255764514|r 428 ASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSK--KIQLLAVTHAPQVA-ARADRHFLVYK 504 (554) Q Consensus 428 aSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~--~~Qvi~ITH~pqvA-a~a~~h~~v~K 504 (554) +|||++=|+++|-.++ ..++.+++||.=+|++-.+...|-+.|+++.+ ..=+|.|||-+..| ..||+-+...+ T Consensus 132 LSGGqkQRvaiARaL~----~~P~llllDEPts~LD~~~~~~i~~~l~~l~~~~g~tii~vTHdl~~a~~laDri~vm~~ 207 (220) T cd03293 132 LSGGMRQRVALARALA----VDPDVLLLDEPFSALDALTREQLQEELLDIWRETGKTVLLVTHDIDEAVFLADRVVVLSA 207 (220) T ss_pred CCHHHHHHHHHHHHHH----CCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHCCCEEEEECCCHHHHHHHCCEEEEEEC T ss_conf 9999999999999986----699999980887656999999999999999985199999988889999996999999858 No 209 >COG4181 Predicted ABC-type transport system involved in lysophospholipase L1 biosynthesis, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Probab=98.03 E-value=3.2e-05 Score=53.36 Aligned_cols=75 Identities=35% Similarity=0.402 Sum_probs=61.6 Q ss_pred HHHCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHC--CCEEEEECHHHHHHHCCCEEEEE Q ss_conf 4406215799999999984366899769980344688879999999999997305--93999808379865017617999 Q gi|255764514|r 426 KLASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSKK--IQLLAVTHAPQVAARADRHFLVY 503 (554) Q Consensus 426 kiaSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~~--~Qvi~ITH~pqvAa~a~~h~~v~ 503 (554) .-+||||.-|+++|=.|+. ....++-||---|+++.|+.+|+++|=.+-.. +-.+.|||=|++|++.++.+.+. T Consensus 145 ~qLSGGEQQRVAiARAfa~----~P~vLfADEPTGNLD~~Tg~~iaDLlF~lnre~G~TlVLVTHDp~LA~Rc~R~~r~~ 220 (228) T COG4181 145 AQLSGGEQQRVALARAFAG----RPDVLFADEPTGNLDRATGDKIADLLFALNRERGTTLVLVTHDPQLAARCDRQLRLR 220 (228) T ss_pred CCCCCHHHHHHHHHHHHCC----CCCEEECCCCCCCCCHHHHHHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHEEEEE T ss_conf 0138517889999997558----987786048988702677889999999876614736999937989987644314401 Q ss_pred E Q ss_conf 9 Q gi|255764514|r 504 K 504 (554) Q Consensus 504 K 504 (554) - T Consensus 221 ~ 221 (228) T COG4181 221 S 221 (228) T ss_pred C T ss_conf 4 No 210 >PRK11288 araG L-arabinose transporter ATP-binding protein; Provisional Probab=98.02 E-value=6.5e-05 Score=51.36 Aligned_cols=96 Identities=20% Similarity=0.292 Sum_probs=71.0 Q ss_pred HHCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHC-CCEEEEECHH-HHHHHCCCEEEEEE Q ss_conf 406215799999999984366899769980344688879999999999997305-9399980837-98650176179999 Q gi|255764514|r 427 LASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSKK-IQLLAVTHAP-QVAARADRHFLVYK 504 (554) Q Consensus 427 iaSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~~-~Qvi~ITH~p-qvAa~a~~h~~v~K 504 (554) -+|||++=|+++|-.++ .+++.+|+||.=+|++-.+...|.++|+++++. .=||+|||=. -++.++|+=+++.+ T Consensus 396 ~LSGGq~QRvaiAraL~----~~p~vLilDEPT~GLD~~~~~~i~~ll~~l~~~G~tvl~ITHDl~~~~~~aDRv~vm~~ 471 (501) T PRK11288 396 NLSGGNQQKAILGRWLS----EDMKVILLDEPTRGIDVGAKHEIYNVIYELAAQGVAVLVVSSDLPEVLGVADRIVVMRE 471 (501) T ss_pred HCCHHHHHHHHHHHHHH----HCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCEEEEEECCHHHHHHHCCEEEEEEC T ss_conf 28999999999999997----09998999798778999999999999999996899999990768999986999999989 Q ss_pred EECCCCCCEEEEEEEECCHHHHH-HH-HHHHHCC Q ss_conf 62168752589999975988999-99-9998668 Q gi|255764514|r 505 TNKPDDTQRIETYVAVLTPQERR-EE-IARMLAG 536 (554) Q Consensus 505 ~~~~~~~~~~~~~i~~l~~~~r~-~E-iarml~g 536 (554) | + -|...+.+|=- ++ ++-|+|+ T Consensus 472 ----G---~---Iv~~~~~~e~~~~~i~~~~~~~ 495 (501) T PRK11288 472 ----G---R---IAGELAREQATERQALSLALPR 495 (501) T ss_pred ----C---E---EEEEECHHHCCHHHHHHHHHCC T ss_conf ----9---9---9999686986999999987265 No 211 >cd03220 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transporter subfamily is involved in extracellular polysaccharide export. Among the variety of membrane-linked or extracellular polysaccharides excreted by bacteria, only capsular polysaccharides, lipopolysaccharides, and teichoic acids have been shown to be exported by ABC transporters. A typical system is made of a conserved integral membrane and an ABC. In addition to these proteins, capsular polysaccharide exporter systems require two 'accessory' proteins to perform their function: a periplasmic (E.coli) or a lipid-anchored outer membrane protein called OMA (Neisseria meningitidis and Haemophilus influenzae) and a cytoplasmic membrane protein MPA2. Probab=98.02 E-value=5.2e-05 Score=51.98 Aligned_cols=73 Identities=25% Similarity=0.287 Sum_probs=58.6 Q ss_pred HHCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHC-CCEEEEECHHHHHH-HCCCEEEEE Q ss_conf 406215799999999984366899769980344688879999999999997305-93999808379865-017617999 Q gi|255764514|r 427 LASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSKK-IQLLAVTHAPQVAA-RADRHFLVY 503 (554) Q Consensus 427 iaSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~~-~Qvi~ITH~pqvAa-~a~~h~~v~ 503 (554) -+|||.+-|+++|..++ ..++.+++||.=+|++-.+...+-+.|+++.+. .=||++||-...+. .+|+=+... T Consensus 142 ~LSgG~kqRl~iA~al~----~~P~illLDEPt~gLD~~~~~~i~~~i~~l~~~g~tiii~sH~l~~v~~lcdriivl~ 216 (224) T cd03220 142 TYSSGMKARLAFAIATA----LEPDILLIDEVLAVGDAAFQEKCQRRLRELLKQGKTVILVSHDPSSIKRLCDRALVLE 216 (224) T ss_pred CCCHHHHHHHHHHHHHH----CCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCEEEEECCCHHHHHHHCCEEEEEE T ss_conf 46999999999999996----6999999918866569999999999999998589999998898899999699999998 No 212 >cd03261 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins. Probab=98.02 E-value=6.5e-05 Score=51.32 Aligned_cols=72 Identities=29% Similarity=0.389 Sum_probs=59.4 Q ss_pred HCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHC--CCEEEEECHHHHHHH-CCCEEEEE Q ss_conf 06215799999999984366899769980344688879999999999997305--939998083798650-17617999 Q gi|255764514|r 428 ASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSKK--IQLLAVTHAPQVAAR-ADRHFLVY 503 (554) Q Consensus 428 aSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~~--~Qvi~ITH~pqvAa~-a~~h~~v~ 503 (554) +|||++=|+++|-.++ ..++.++|||.=+|++-.+...|-+.+++|.+. .=+|+|||-..+|.. +|+=+... T Consensus 137 LSGGq~QRvaIARALv----~~P~illlDEPts~LDp~~~~~i~~li~~l~~~~g~T~i~vTHd~~~a~~~~Dri~vm~ 211 (235) T cd03261 137 LSGGMKKRVALARALA----LDPELLLYDEPTAGLDPIASGVIDDLIRSLKKELGLTSIMVTHDLDTAFAIADRIAVLY 211 (235) T ss_pred CCHHHHHHHHHHHHHH----CCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHHCCEEEEECCCHHHHHHHCCEEEEEE T ss_conf 6999999999999985----48998998088664798999999999999999729999998989899999699899998 No 213 >cd03299 ABC_ModC_like Archeal protein closely related to ModC. ModC is an ABC-type transporter and the ATPase component of a molybdate transport system that also includes the periplasmic binding protein ModA and the membrane protein ModB. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins. Probab=98.02 E-value=5.1e-05 Score=52.01 Aligned_cols=73 Identities=29% Similarity=0.340 Sum_probs=60.3 Q ss_pred HCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHC--CCEEEEECHHHHHH-HCCCEEEEEE Q ss_conf 06215799999999984366899769980344688879999999999997305--93999808379865-0176179999 Q gi|255764514|r 428 ASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSKK--IQLLAVTHAPQVAA-RADRHFLVYK 504 (554) Q Consensus 428 aSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~~--~Qvi~ITH~pqvAa-~a~~h~~v~K 504 (554) +|||++-|+++|-.++ ..+..++|||.=+|++-.+...+-+.|+++.+. .=+|+|||-+..|. .||+=....+ T Consensus 130 LSGGq~QRVaiARAl~----~~P~llllDEP~s~LD~~~~~~i~~~l~~l~~~~~~T~i~vTHd~~~a~~~aDri~vl~~ 205 (235) T cd03299 130 LSGGEQQRVAIARALV----VNPKILLLDEPFSALDVRTKEKLREELKKIRKEFGVTVLHVTHDFEEAWALADKVAIMLN 205 (235) T ss_pred CCHHHHHHHHHHHHHH----CCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHHCCEEEEECCCHHHHHHHCCEEEEEEC T ss_conf 8999999999999997----389989992887646999999999999999998299999987899999996999999989 No 214 >PRK13638 cbiO cobalt transporter ATP-binding subunit; Provisional Probab=98.02 E-value=1.3e-05 Score=56.05 Aligned_cols=39 Identities=31% Similarity=0.445 Sum_probs=32.5 Q ss_pred ECCEEEEEEEEECCCC-EEEEECCCCCCHHHHHHHHHHHH Q ss_conf 4227899998873898-18998899978889999999871 Q gi|255764514|r 7 YNIVLIESLDIDFSAG-LSILSGDTGSGKSILLDALILVT 45 (554) Q Consensus 7 ~Nf~~i~~~~i~f~~G-l~vItGetGaGKS~ildAl~~~l 45 (554) .+...++++++++.+| +++|+||||||||+++.+|.=++ T Consensus 12 g~~~vL~~vsl~i~~Gei~~liGpNGaGKSTLlk~l~Gl~ 51 (271) T PRK13638 12 QDEPVLKGLNLDFSLSPVTGLVGANGCGKSTLFMNLSGLL 51 (271) T ss_pred CCEEEEECCEEEECCCCEEEEECCCCCCHHHHHHHHHCCC T ss_conf 9998896418798389799999999980999999996688 No 215 >TIGR03410 urea_trans_UrtE urea ABC transporter, ATP-binding protein UrtE. Members of this protein family are ABC transporter ATP-binding subunits associated with urea transport and metabolism. This protein is found in a conserved five-gene transport operon typically found adjacent to urease genes. It was shown in Cyanobacteria that disruption leads to the loss of high-affinity urea transport activity. Probab=98.01 E-value=0.00021 Score=48.05 Aligned_cols=72 Identities=28% Similarity=0.407 Sum_probs=57.9 Q ss_pred HCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCC--CEEEEECHHHHH-HHCCCEEEEEE Q ss_conf 062157999999999843668997699803446888799999999999973059--399980837986-50176179999 Q gi|255764514|r 428 ASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSKKI--QLLAVTHAPQVA-ARADRHFLVYK 504 (554) Q Consensus 428 aSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~~~--Qvi~ITH~pqvA-a~a~~h~~v~K 504 (554) +|||++-|+++|-.++ ..++.++|||-=+|++-.....+.+.|+++.+.. =||+|||-+..| ++||+ +.|-. T Consensus 132 LSGGq~Qrv~iAraL~----~~P~lLlLDEPt~gLD~~~~~~i~~~i~~l~~~~g~tvl~vtH~l~~~~~~adr-v~vl~ 206 (230) T TIGR03410 132 LSGGQQQQLAIARALV----TRPKLLLLDEPTEGIQPSIIKDIGRVIRRLRAEGGMAILLVEQYLDFARELADR-YYVME 206 (230) T ss_pred CCHHHHHHHHHHHHHH----CCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCCEEEEEECCHHHHHHHCCE-EEEEE T ss_conf 9999999999999996----299889993852269999999999999999971798999990888999996999-99995 No 216 >PRK10575 iron-hydroxamate transporter ATP-binding subunit; Provisional Probab=98.01 E-value=1.3e-05 Score=55.85 Aligned_cols=35 Identities=43% Similarity=0.622 Sum_probs=30.3 Q ss_pred CCEEEEEEEEECCCC-EEEEECCCCCCHHHHHHHHH Q ss_conf 227899998873898-18998899978889999999 Q gi|255764514|r 8 NIVLIESLDIDFSAG-LSILSGDTGSGKSILLDALI 42 (554) Q Consensus 8 Nf~~i~~~~i~f~~G-l~vItGetGaGKS~ildAl~ 42 (554) +...++++++++.+| +++|+||||||||+++..|+ T Consensus 23 ~~~vL~~vsl~i~~Ge~~~liG~NGaGKSTLl~~l~ 58 (265) T PRK10575 23 GRTLLHPLSLTFPAGKVTGLIGHNGSGKSTLLKMLG 58 (265) T ss_pred CEEEEECEEEEECCCCEEEEECCCCCHHHHHHHHHH T ss_conf 999881508898799899999999980999999995 No 217 >PRK13631 cbiO cobalt transporter ATP-binding subunit; Provisional Probab=98.01 E-value=1.2e-05 Score=56.08 Aligned_cols=36 Identities=25% Similarity=0.473 Sum_probs=30.3 Q ss_pred EEEEEEEEECCCC-EEEEECCCCCCHHHHHHHHHHHH Q ss_conf 7899998873898-18998899978889999999871 Q gi|255764514|r 10 VLIESLDIDFSAG-LSILSGDTGSGKSILLDALILVT 45 (554) Q Consensus 10 ~~i~~~~i~f~~G-l~vItGetGaGKS~ildAl~~~l 45 (554) ..++++++++.+| +++|+|+||||||+++.+|+-++ T Consensus 40 ~AL~~Is~~i~~Ge~vaIIG~nGsGKSTL~~~l~Gll 76 (320) T PRK13631 40 VALNNISYTFEKNKIYFIIGNSGSGKSTLVTHFNGLI 76 (320) T ss_pred EEEECCEEEECCCCEEEEECCCCCCHHHHHHHHHCCC T ss_conf 9861645588599899999499984999999997588 No 218 >PRK10247 putative ABC transporter ATP-binding protein YbbL; Provisional Probab=98.01 E-value=1.5e-05 Score=55.60 Aligned_cols=38 Identities=24% Similarity=0.589 Sum_probs=31.5 Q ss_pred CCEEEEEEEEECCCC-EEEEECCCCCCHHHHHHHHHHHH Q ss_conf 227899998873898-18998899978889999999871 Q gi|255764514|r 8 NIVLIESLDIDFSAG-LSILSGDTGSGKSILLDALILVT 45 (554) Q Consensus 8 Nf~~i~~~~i~f~~G-l~vItGetGaGKS~ildAl~~~l 45 (554) +-..++++++++.+| +++|+||||||||+++..|+-.+ T Consensus 19 ~~~iL~~is~~i~~Ge~~~i~G~sGsGKSTLlk~i~gl~ 57 (225) T PRK10247 19 DTKILNNINFSLRAGEFKLITGPSGCGKSTLLKIVASLI 57 (225) T ss_pred CEEEEECEEEEECCCCEEEEECCCCCCHHHHHHHHHCCC T ss_conf 989994517998599699999999999999999996466 No 219 >PRK09536 btuD corrinoid ABC transporter ATPase; Reviewed Probab=98.01 E-value=1.3e-05 Score=56.01 Aligned_cols=74 Identities=24% Similarity=0.299 Sum_probs=60.4 Q ss_pred HCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHC-CCEEEEECHHHHHHHCCCEEEEEEE Q ss_conf 06215799999999984366899769980344688879999999999997305-9399980837986501761799996 Q gi|255764514|r 428 ASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSKK-IQLLAVTHAPQVAARADRHFLVYKT 505 (554) Q Consensus 428 aSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~~-~Qvi~ITH~pqvAa~a~~h~~v~K~ 505 (554) +||||+=|++||-.++ ...+.+||||--+|++-.....+-++|++|.+. .=||+|||--..|+.=-.|+.|-+. T Consensus 139 LSGGqrQRV~IARALa----q~P~ILLLDEPTs~LDi~~q~ell~lLr~L~~~G~TVI~vtHDL~lA~~~cDrVivl~~ 213 (409) T PRK09536 139 LSGGERQRVLLARALA----QATPVLLLDEPTASLDINHQIRTLELVRDLADDGKTVVAAIHDLNLAARYCDELVLLAD 213 (409) T ss_pred CCHHHHHHHHHHHHHH----CCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCEEEEEECCHHHHHHHCCEEEEEEC T ss_conf 8999999999999996----79998999587667999999999999999985899999995689999986999999989 No 220 >PRK13549 xylose transporter ATP-binding subunit; Provisional Probab=98.00 E-value=2.8e-05 Score=53.80 Aligned_cols=37 Identities=30% Similarity=0.571 Sum_probs=31.1 Q ss_pred CCEEEEEEEEECCCC-EEEEECCCCCCHHHHHHHHHHH Q ss_conf 227899998873898-1899889997888999999987 Q gi|255764514|r 8 NIVLIESLDIDFSAG-LSILSGDTGSGKSILLDALILV 44 (554) Q Consensus 8 Nf~~i~~~~i~f~~G-l~vItGetGaGKS~ildAl~~~ 44 (554) ++...+++++++.+| +.+|+||||||||+++.+|.-+ T Consensus 17 ~~~aL~~vsl~i~~Ge~~~lvG~nGsGKSTL~~~l~Gl 54 (513) T PRK13549 17 GVKALDNISLRVRAGEIVSLCGENGAGKSTLMKVLSGV 54 (513) T ss_pred CEEEECCEEEEECCCCEEEEECCCCCHHHHHHHHHHCC T ss_conf 99997563899889979999899997299999999567 No 221 >cd03219 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine. MJ1267 is a branched-chain amino acid transporter with 29% similarity to both the LivF and LivG components of the E. coli branched-chain amino acid transporter. MJ1267 contains an insertion from residues 114 to 123 characteristic of LivG (Leucine-Isoleucine-Valine) homologs. The branched-chain amino acid transporter from E. coli comprises a heterodimer of ABCs (LivF and LivG), a heterodimer of six-helix TM domains (LivM and LivH), and one of two alternative soluble periplasmic substrate binding proteins (LivK or LivJ). Probab=98.00 E-value=6.5e-05 Score=51.35 Aligned_cols=74 Identities=23% Similarity=0.302 Sum_probs=60.6 Q ss_pred HHCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHH-CCCEEEEECHHHH-HHHCCCEEEEEE Q ss_conf 40621579999999998436689976998034468887999999999999730-5939998083798-650176179999 Q gi|255764514|r 427 LASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSK-KIQLLAVTHAPQV-AARADRHFLVYK 504 (554) Q Consensus 427 iaSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~-~~Qvi~ITH~pqv-Aa~a~~h~~v~K 504 (554) -+|||++=|+++|-.++ ..++.+||||.-+|++-.+...|-+.|+++.+ ..=||+|||-... +..+|+-+.+.+ T Consensus 143 ~LSGG~~Qrv~iAral~----~~P~lliLDEPT~gLD~~~~~~i~~~l~~l~~~G~tii~vsHdl~~~~~~~Drv~vm~~ 218 (236) T cd03219 143 ELSYGQQRRLEIARALA----TDPKLLLLDEPAAGLNPEETEELAELIRELRERGITVLLVEHDMDVVMSLADRVTVLDQ 218 (236) T ss_pred HCCHHHHHHHHHHHHHH----CCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCEEEEECCCHHHHHHHCCEEEEEEC T ss_conf 69999999999999996----59999999487658999999999999999996599999991748999996999999989 No 222 >PRK03695 vitamin B12-transporter ATPase; Provisional Probab=98.00 E-value=8.7e-05 Score=50.52 Aligned_cols=77 Identities=29% Similarity=0.352 Sum_probs=58.4 Q ss_pred HHCCHHHHHHHHHHHHHHC--CCCC-CCEEEEECCCCCCCHHHHHHHHHHHHHHHHC-CCEEEEECHHH-HHHHCCCEEE Q ss_conf 4062157999999999843--6689-9769980344688879999999999997305-93999808379-8650176179 Q gi|255764514|r 427 LASGGELSRFLLALKIVLV--DQGS-IPTLVFDEVDSGIGGAVADAIGYRLKQLSKK-IQLLAVTHAPQ-VAARADRHFL 501 (554) Q Consensus 427 iaSGGE~Sr~~LAl~~~~~--~~~~-~p~~ifDEiDagi~G~~a~~v~~~l~~ls~~-~Qvi~ITH~pq-vAa~a~~h~~ 501 (554) -+||||+=|++||..++.- ...| ++.++|||.-+|++-.....+-++++++.+. .=||+|||-+. +..++|+=+. T Consensus 123 ~LSgGq~Qrv~la~all~i~~a~~p~p~illLDEPt~gLD~~~~~~l~~~i~~l~~~g~tIi~vtHdl~~~~~~~dri~v 202 (245) T PRK03695 123 QLSGGEWQRVRLAAVVLQVWPDINPAGQLLLLDEPMNSLDVAQQSALDRLLSELCQQGIAVVMSSHDLNHTLRHADRVWL 202 (245) T ss_pred HCCHHHHHHHHHHHHHHHCCCCCCCCCCEEEECCCCCCCCHHHHHHHHHHHHHHHHCCCEEEEEECCHHHHHHHCCEEEE T ss_conf 68988999999999996327232788878997387667899999999999999984799999994268999997999999 Q ss_pred EE Q ss_conf 99 Q gi|255764514|r 502 VY 503 (554) Q Consensus 502 v~ 503 (554) +. T Consensus 203 l~ 204 (245) T PRK03695 203 LK 204 (245) T ss_pred EE T ss_conf 98 No 223 >PRK09544 znuC high-affinity zinc transporter ATPase; Reviewed Probab=98.00 E-value=1.7e-05 Score=55.24 Aligned_cols=39 Identities=21% Similarity=0.424 Sum_probs=32.6 Q ss_pred ECCEEEEEEEEECCCC-EEEEECCCCCCHHHHHHHHHHHH Q ss_conf 4227899998873898-18998899978889999999871 Q gi|255764514|r 7 YNIVLIESLDIDFSAG-LSILSGDTGSGKSILLDALILVT 45 (554) Q Consensus 7 ~Nf~~i~~~~i~f~~G-l~vItGetGaGKS~ildAl~~~l 45 (554) -+...++++++++.+| +.+|+||||||||+++.+|.-.+ T Consensus 15 g~~~vL~~vs~~i~~Gei~~LiGpNGaGKSTLlk~I~Gl~ 54 (251) T PRK09544 15 GQRRVLSDVSLELKPGKILTLLGPNGAGKSTLVRVVLGLV 54 (251) T ss_pred CCEEEEECEEEEECCCCEEEEECCCCCCHHHHHHHHHCCC T ss_conf 9999996307898799799999899988999999996688 No 224 >cd03213 ABCG_EPDR ABCG transporters are involved in eye pigment (EP) precursor transport, regulation of lipid-trafficking mechanisms, and pleiotropic drug resistance (DR). DR is a well-described phenomenon occurring in fungi and shares several similarities with processes in bacteria and higher eukaryotes. Compared to other members of the ABC transporter subfamilies, the ABCG transporter family is composed of proteins that have an ATP-binding cassette domain at the N-terminus and a TM (transmembrane) domain at the C-terminus. Probab=97.99 E-value=1.5e-05 Score=55.60 Aligned_cols=40 Identities=35% Similarity=0.583 Sum_probs=33.2 Q ss_pred EEEEECCEE-------------EEEEEEECCCC-EEEEECCCCCCHHHHHHHHH Q ss_conf 599942278-------------99998873898-18998899978889999999 Q gi|255764514|r 3 RLSIYNIVL-------------IESLDIDFSAG-LSILSGDTGSGKSILLDALI 42 (554) Q Consensus 3 ~L~i~Nf~~-------------i~~~~i~f~~G-l~vItGetGaGKS~ildAl~ 42 (554) .|.++|+-. .+++++++.+| +++|.||||||||+++.+|+ T Consensus 3 ~i~~~nls~~y~~~~~~~~k~iL~~vs~~v~~Gei~~ilGpnGaGKSTLl~~l~ 56 (194) T cd03213 3 TLSFRNLTVTVKSSPSKSGKQLLKNVSGKAKPGELTAIMGPSGAGKSTLLNALA 56 (194) T ss_pred EEEEEEEEEEECCCCCCCCCEEEECCEEEEECCEEEEEECCCCCHHHHHHHHHH T ss_conf 899998999978999889998788838899088199999899951999999985 No 225 >PRK09984 phosphonate/organophosphate ester transporter subunit; Provisional Probab=97.98 E-value=1.3e-05 Score=55.88 Aligned_cols=39 Identities=31% Similarity=0.456 Sum_probs=33.1 Q ss_pred ECCEEEEEEEEECCCC-EEEEECCCCCCHHHHHHHHHHHH Q ss_conf 4227899998873898-18998899978889999999871 Q gi|255764514|r 7 YNIVLIESLDIDFSAG-LSILSGDTGSGKSILLDALILVT 45 (554) Q Consensus 7 ~Nf~~i~~~~i~f~~G-l~vItGetGaGKS~ildAl~~~l 45 (554) .++...+++++++.+| +.+|+||||||||+++.+|.-++ T Consensus 15 g~~~aL~~isl~i~~GE~~~iiGpNGaGKSTLlk~i~Gll 54 (262) T PRK09984 15 NQHQALHAVDLNIHHGEMVALLGPSGSGKSTLLRHLSGLI 54 (262) T ss_pred CCEEEECCEEEEECCCCEEEEECCCCCHHHHHHHHHHCCC T ss_conf 9986774527898799899999899960999999997567 No 226 >cd03268 ABC_BcrA_bacitracin_resist The BcrA subfamily represents ABC transporters involved in peptide antibiotic resistance. Bacitracin is a dodecapeptide antibiotic produced by B. licheniformis and B. subtilis. The synthesis of bacitracin is non-ribosomally catalyzed by a multienzyme complex BcrABC. Bacitracin has potent antibiotic activity against gram-positive bacteria. The inhibition of peptidoglycan biosynthesis is the best characterized bacterial effect of bacitracin. The bacitracin resistance of B. licheniformis is mediated by the ABC transporter Bcr which is composed of two identical BcrA ATP-binding subunits and one each of the integral membrane proteins, BcrB and BcrC. B. subtilis cells carrying bcr genes on high-copy number plasmids develop collateral detergent sensitivity, a similar phenomenon in human cells with overexpressed multi-drug resistance P-glycoprotein. Probab=97.98 E-value=8.1e-05 Score=50.70 Aligned_cols=73 Identities=23% Similarity=0.286 Sum_probs=58.3 Q ss_pred HHCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHC-CCEEEEECH-HHHHHHCCCEEEEE Q ss_conf 406215799999999984366899769980344688879999999999997305-939998083-79865017617999 Q gi|255764514|r 427 LASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSKK-IQLLAVTHA-PQVAARADRHFLVY 503 (554) Q Consensus 427 iaSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~~-~Qvi~ITH~-pqvAa~a~~h~~v~ 503 (554) -+|||.+-|+++|..++ .+++.+||||.=+|++-.....+-+.|+++++. .=||++||. +-+...+|+=+.+. T Consensus 126 ~LS~G~kqrl~la~al~----~~p~lliLDEPt~GLD~~~~~~i~~~l~~l~~~g~til~~sH~l~e~~~~~dri~vl~ 200 (208) T cd03268 126 GFSLGMKQRLGIALALL----GNPDLLILDEPTNGLDPDGIKELRELILSLRDQGITVLISSHLLSEIQKVADRIGIIN 200 (208) T ss_pred HCCHHHHHHHHHHHHHH----CCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCEEEEECCCHHHHHHHCCEEEEEE T ss_conf 69999999999999985----6999999938876899999999999999999589999998986899999699999998 No 227 >COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] Probab=97.97 E-value=6.6e-05 Score=51.31 Aligned_cols=39 Identities=28% Similarity=0.456 Sum_probs=32.6 Q ss_pred CCEEEEEEEEECCCC-EEEEECCCCCCHHHHHHHHHHHHC Q ss_conf 227899998873898-189988999788899999998714 Q gi|255764514|r 8 NIVLIESLDIDFSAG-LSILSGDTGSGKSILLDALILVTG 46 (554) Q Consensus 8 Nf~~i~~~~i~f~~G-l~vItGetGaGKS~ildAl~~~lG 46 (554) +-.+++++++.+.+| +++|.||||||||++|.+|.=.+- T Consensus 14 ~~~il~~ls~~i~~G~i~~iiGpNG~GKSTLLk~l~~~l~ 53 (258) T COG1120 14 GKPILDDLSFSIPKGEITGILGPNGSGKSTLLKCLAGLLK 53 (258) T ss_pred CEEEEECCEEEECCCCEEEEECCCCCCHHHHHHHHHCCCC T ss_conf 9168722368865997999989988899999999865678 No 228 >cd03217 ABC_FeS_Assembly ABC-type transport system involved in Fe-S cluster assembly, ATPase component. Biosynthesis of iron-sulfur clusters (Fe-S) depends on multiprotein systems. The SUF system of E. coli and Erwinia chrysanthemi is important for Fe-S biogenesis under stressful conditions. The SUF system is made of six proteins: SufC is an atypical cytoplasmic ABC-ATPase, which forms a complex with SufB and SufD; SufA plays the role of a scaffold protein for assembly of iron-sulfur clusters and delivery to target proteins; SufS is a cysteine desulfurase which mobilizes the sulfur atom from cysteine and provides it to the cluster; SufE has no associated function yet. Probab=97.97 E-value=1.5e-05 Score=55.46 Aligned_cols=38 Identities=26% Similarity=0.511 Sum_probs=32.9 Q ss_pred EEECCEEEEEEEEECCCC-EEEEECCCCCCHHHHHHHHH Q ss_conf 994227899998873898-18998899978889999999 Q gi|255764514|r 5 SIYNIVLIESLDIDFSAG-LSILSGDTGSGKSILLDALI 42 (554) Q Consensus 5 ~i~Nf~~i~~~~i~f~~G-l~vItGetGaGKS~ildAl~ 42 (554) +.-+...++++++++.+| +.+|.||||||||+++..|. T Consensus 9 ~yg~~~vL~~vsl~v~~Gei~~iiGpnGaGKSTLl~~i~ 47 (200) T cd03217 9 SVGGKEILKGVNLTIKKGEVHALMGPNGSGKSTLAKTIM 47 (200) T ss_pred EECCEEEEECCEEEECCCCEEEEECCCCCCHHHHHHHHC T ss_conf 999999885505688799899999689999999999970 No 229 >PRK13540 cytochrome c biogenesis protein CcmA; Provisional Probab=97.97 E-value=2e-05 Score=54.78 Aligned_cols=41 Identities=27% Similarity=0.457 Sum_probs=32.9 Q ss_pred EEECCEEEEEEEEECCCC-EEEEECCCCCCHHHHHHHHHHHH Q ss_conf 994227899998873898-18998899978889999999871 Q gi|255764514|r 5 SIYNIVLIESLDIDFSAG-LSILSGDTGSGKSILLDALILVT 45 (554) Q Consensus 5 ~i~Nf~~i~~~~i~f~~G-l~vItGetGaGKS~ildAl~~~l 45 (554) ...+-.+++++++++.+| +.+|+||||||||+++..|+-.+ T Consensus 10 ~y~~~~vl~~is~~i~~G~i~~l~G~NGaGKSTLlkli~Gl~ 51 (200) T PRK13540 10 DYHDQPLLQQISFHLPAGGLLHLKGSNGAGKTTLLKLIAGLL 51 (200) T ss_pred EECCEEEEECEEEEECCCCEEEEECCCCCCHHHHHHHHHCCC T ss_conf 999999881227898799799998899987999999997785 No 230 >cd03300 ABC_PotA_N PotA is an ABC-type transporter and the ATPase component of the spermidine/putrescine-preferential uptake system consisting of PotA, -B, -C, and -D. PotA has two domains with the N-terminal domain containing the ATPase activity and the residues required for homodimerization with PotA and heterdimerization with PotB. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins. Probab=97.97 E-value=7.3e-05 Score=51.02 Aligned_cols=71 Identities=28% Similarity=0.383 Sum_probs=59.3 Q ss_pred HCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHC--CCEEEEECHHHHHHH-CCCEEEE Q ss_conf 06215799999999984366899769980344688879999999999997305--939998083798650-1761799 Q gi|255764514|r 428 ASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSKK--IQLLAVTHAPQVAAR-ADRHFLV 502 (554) Q Consensus 428 aSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~~--~Qvi~ITH~pqvAa~-a~~h~~v 502 (554) +|||++-|+++|-.++ ..++.++|||-=++++-.+...+-..|+++-+. .=+|.|||-+..|.. ||+=... T Consensus 131 LSGGqkQRVaiARAl~----~~P~llllDEP~s~LD~~~~~~i~~~l~~l~~~~~~T~i~VTHd~~ea~~ladri~vm 204 (232) T cd03300 131 LSGGQQQRVAIARALV----NEPKVLLLDEPLGALDLKLRKDMQLELKRLQKELGITFVFVTHDQEEALTMSDRIAVM 204 (232) T ss_pred CCHHHHHHHHHHHHHH----CCCCEEEECCCCCCCCHHHHHHHHHHHHHHHHHHCCEEEEECCCHHHHHHHCCEEEEE T ss_conf 9989999999999986----5999999808876469999999999999999985999999999999999969999999 No 231 >COG0488 Uup ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] Probab=97.97 E-value=4.1e-05 Score=52.67 Aligned_cols=77 Identities=27% Similarity=0.331 Sum_probs=60.1 Q ss_pred CCHHHHHHCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCEEEEECHHHH-HHHCCCE Q ss_conf 311354406215799999999984366899769980344688879999999999997305939998083798-6501761 Q gi|255764514|r 421 PGPLMKLASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSKKIQLLAVTHAPQV-AARADRH 499 (554) Q Consensus 421 ~~pl~kiaSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~~~Qvi~ITH~pqv-Aa~a~~h 499 (554) .+|+. .+||||++|++||..+. .++.++|+||.--.++=.+-..+.+.|....- =||+|||=+.. -+.|+.. T Consensus 434 ~~~v~-~LSGGEk~Rl~La~ll~----~~pNvLlLDEPTNhLDi~s~eaLe~aL~~f~G--tvl~VSHDr~Fl~~va~~i 506 (530) T COG0488 434 EKPVG-VLSGGEKARLLLAKLLL----QPPNLLLLDEPTNHLDIESLEALEEALLDFEG--TVLLVSHDRYFLDRVATRI 506 (530) T ss_pred CCCHH-HCCHHHHHHHHHHHHHC----CCCCEEEECCCCCCCCHHHHHHHHHHHHHCCC--EEEEEECCHHHHHHHCCEE T ss_conf 39522-25877999999999856----69978997289876798899999999985898--6999948999998333239 Q ss_pred EEEEE Q ss_conf 79999 Q gi|255764514|r 500 FLVYK 504 (554) Q Consensus 500 ~~v~K 504 (554) |.+.. T Consensus 507 ~~~~~ 511 (530) T COG0488 507 WLVED 511 (530) T ss_pred EEECC T ss_conf 99848 No 232 >PRK11819 putative ABC transporter ATP-binding protein; Reviewed Probab=97.96 E-value=3e-05 Score=53.57 Aligned_cols=100 Identities=21% Similarity=0.217 Sum_probs=68.7 Q ss_pred CHHHHHHCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCEEEEECHHHHHHHCCCEEE Q ss_conf 11354406215799999999984366899769980344688879999999999997305939998083798650176179 Q gi|255764514|r 422 GPLMKLASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSKKIQLLAVTHAPQVAARADRHFL 501 (554) Q Consensus 422 ~pl~kiaSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~~~Qvi~ITH~pqvAa~a~~h~~ 501 (554) +|++ .+||||+.|++||..++ .++.++||||.-.+++=.+.+.+.+.|..... =||+|||=..--..--+++. T Consensus 441 ~~v~-~LSGGek~Rv~lA~~l~----~~p~lLiLDEPTn~LDi~s~e~Le~aL~~y~G--tvl~VSHDr~fi~~va~~i~ 513 (556) T PRK11819 441 KKVG-VLSGGERNRLHLAKTLK----SGGNVLLLDEPTNDLDVETLRALEDALLEFPG--CAVVISHDRWFLDRIATHIL 513 (556) T ss_pred CCCC-CCCHHHHHHHHHHHHHH----CCCCEEEEECCCCCCCHHHHHHHHHHHHHCCC--EEEEEECCHHHHHHHCCEEE T ss_conf 9703-18899999999999996----29898999297756799999999999987799--69999789999998688899 Q ss_pred EEEEECCCCCCEEEEEEEECCHHHHHHHHHHHHC Q ss_conf 9996216875258999997598899999999866 Q gi|255764514|r 502 VYKTNKPDDTQRIETYVAVLTPQERREEIARMLA 535 (554) Q Consensus 502 v~K~~~~~~~~~~~~~i~~l~~~~r~~Eiarml~ 535 (554) +.+. ++ + .....=+.++=.++..|=++ T Consensus 514 ~~~~--~g---~--v~~~~g~y~~y~~~~~~~~~ 540 (556) T PRK11819 514 AFEG--DS---K--VEWFEGNFQEYEEDKKRRLG 540 (556) T ss_pred EEEC--CC---E--EEEECCCHHHHHHHHHHHHC T ss_conf 9988--98---7--99906899999999998620 No 233 >cd03260 ABC_PstB_phosphate_transporter Phosphate uptake is of fundamental importance in the cell physiology of bacteria because phosphate is required as a nutrient. The Pst system of E. coli comprises four distinct subunits encoded by the pstS, pstA, pstB, and pstC genes. The PstS protein is a phosphate-binding protein located in the periplasmic space. P stA and PstC are hydrophobic and they form the transmembrane portion of the Pst system. PstB is the catalytic subunit, which couples the energy of ATP hydrolysis to the import of phosphate across cellular membranes through the Pst system, often referred as ABC-protein. PstB belongs to one of the largest superfamilies of proteins characterized by a highly conserved adenosine triphosphate (ATP) binding cassette (ABC), which is also a nucleotide binding domain (NBD). Probab=97.96 E-value=2.6e-05 Score=53.96 Aligned_cols=39 Identities=28% Similarity=0.469 Sum_probs=33.5 Q ss_pred ECCEEEEEEEEECCCC-EEEEECCCCCCHHHHHHHHHHHH Q ss_conf 4227899998873898-18998899978889999999871 Q gi|255764514|r 7 YNIVLIESLDIDFSAG-LSILSGDTGSGKSILLDALILVT 45 (554) Q Consensus 7 ~Nf~~i~~~~i~f~~G-l~vItGetGaGKS~ildAl~~~l 45 (554) .++...+++++++.+| +++|+||||||||+++..|+.++ T Consensus 11 ~~~~~L~~isl~i~~Ge~~~iiG~SGsGKSTll~~i~gL~ 50 (227) T cd03260 11 GDKHALKDISLDIPKGEITALIGPSGCGKSTLLRLLNRLN 50 (227) T ss_pred CCEEEEECEEEEECCCCEEEEECCCCCCHHHHHHHHHHHH T ss_conf 9998883406788799899999999981999999997445 No 234 >cd03229 ABC_Class3 This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins. Probab=97.96 E-value=9.3e-05 Score=50.33 Aligned_cols=72 Identities=32% Similarity=0.378 Sum_probs=59.5 Q ss_pred HCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHC--CCEEEEECHHHHHHH-CCCEEEEE Q ss_conf 06215799999999984366899769980344688879999999999997305--939998083798650-17617999 Q gi|255764514|r 428 ASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSKK--IQLLAVTHAPQVAAR-ADRHFLVY 503 (554) Q Consensus 428 aSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~~--~Qvi~ITH~pqvAa~-a~~h~~v~ 503 (554) +|||++=|+++|-.++ ..++.++|||.=++++-.+...+-+.|+++.+. .-+|.|||-...|.. ||+=+.+. T Consensus 101 LSGGq~QRvaIARAL~----~~P~ill~DEPts~LD~~~~~~i~~~l~~l~~~~~~t~i~vTHd~~~a~~~aDri~vm~ 175 (178) T cd03229 101 LSGGQQQRVALARALA----MDPDVLLLDEPTSALDPITRREVRALLKSLQAQLGITVVLVTHDLDEAARLADRVVVLR 175 (178) T ss_pred CCCHHHHHHHHHHHHH----CCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHHCCEEEEECCCHHHHHHHCCEEEEEE T ss_conf 7726889999999985----29999997089764799999999999999999649999999899999998699999992 No 235 >PRK13409 putative ATPase RIL; Provisional Probab=97.96 E-value=9.3e-05 Score=50.32 Aligned_cols=23 Identities=30% Similarity=0.455 Sum_probs=18.3 Q ss_pred CCC-EEEEECCCCCCHHHHHHHHH Q ss_conf 898-18998899978889999999 Q gi|255764514|r 20 SAG-LSILSGDTGSGKSILLDALI 42 (554) Q Consensus 20 ~~G-l~vItGetGaGKS~ildAl~ 42 (554) .|| ...|+|+||+|||++|.-|+ T Consensus 97 ~~G~v~GLiG~NGaGKST~lkILs 120 (590) T PRK13409 97 KEGKVTGILGPNGIGKSTAVKILS 120 (590) T ss_pred CCCCEEEEECCCCCCHHHHHHHHH T ss_conf 998789988999998999999995 No 236 >COG1123 ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] Probab=97.96 E-value=9.3e-05 Score=50.31 Aligned_cols=73 Identities=29% Similarity=0.382 Sum_probs=59.3 Q ss_pred HCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHC--CCEEEEEC-HHHHHHHCCCEEEEEE Q ss_conf 06215799999999984366899769980344688879999999999997305--93999808-3798650176179999 Q gi|255764514|r 428 ASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSKK--IQLLAVTH-APQVAARADRHFLVYK 504 (554) Q Consensus 428 aSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~~--~Qvi~ITH-~pqvAa~a~~h~~v~K 504 (554) .|||+.=|+++|-.++. +| ..+|.||.=+.++=-+...|-++|++|-+. .=++.||| ++-|...+|+=.+.++ T Consensus 430 lSGGQrQRvaIARALa~---~P-~lli~DEp~SaLDvsvqa~VlnLl~~lq~e~g~t~lfISHDl~vV~~i~drv~vm~~ 505 (539) T COG1123 430 LSGGQRQRVAIARALAL---EP-KLLILDEPVSALDVSVQAQVLNLLKDLQEELGLTYLFISHDLAVVRYIADRVAVMYD 505 (539) T ss_pred CCCCHHHHHHHHHHHHC---CC-CEEEECCCCCCCCHHHHHHHHHHHHHHHHHHCCEEEEEECCHHHHHHHCCEEEEEEC T ss_conf 38525678999999854---99-899964874322789999999999999997498899995878999863866899978 No 237 >PRK13548 hmuV hemin importer ATP-binding subunit; Provisional Probab=97.96 E-value=2e-05 Score=54.77 Aligned_cols=38 Identities=26% Similarity=0.447 Sum_probs=31.6 Q ss_pred CCEEEEEEEEECCCC-EEEEECCCCCCHHHHHHHHHHHH Q ss_conf 227899998873898-18998899978889999999871 Q gi|255764514|r 8 NIVLIESLDIDFSAG-LSILSGDTGSGKSILLDALILVT 45 (554) Q Consensus 8 Nf~~i~~~~i~f~~G-l~vItGetGaGKS~ildAl~~~l 45 (554) +...++++++++.+| +++|.||||||||+++.+|+-.+ T Consensus 14 ~~~~L~~vsl~i~~Gei~~liGpNGaGKSTLlk~i~Gl~ 52 (257) T PRK13548 14 GKTVLDDVSLTLRPGEVVAILGPNGAGKSTLLRALSGEL 52 (257) T ss_pred CEEEECCEEEEECCCCEEEEECCCCCCHHHHHHHHHCCC T ss_conf 999880337898699899999999987999999985675 No 238 >PRK11300 livG leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Probab=97.95 E-value=0.00011 Score=49.89 Aligned_cols=73 Identities=19% Similarity=0.307 Sum_probs=58.9 Q ss_pred HHCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHC--CCEEEEECHHHHH-HHCCCEEEEE Q ss_conf 406215799999999984366899769980344688879999999999997305--9399980837986-5017617999 Q gi|255764514|r 427 LASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSKK--IQLLAVTHAPQVA-ARADRHFLVY 503 (554) Q Consensus 427 iaSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~~--~Qvi~ITH~pqvA-a~a~~h~~v~ 503 (554) -+|||++=|+++|-.++ ..++.+|+||.-+|++-.+...+-+.|+++.+. .=||+|||-...+ ..+|+=++.. T Consensus 153 ~LSgGq~Qrv~iAraL~----~~P~lLlLDEPt~gLD~~~~~~i~~~i~~l~~~~g~tvl~itHdl~~v~~~aDrv~vl~ 228 (255) T PRK11300 153 NLAYGQQRRLEIARCMV----TQPRILMLDEPAAGLNPKETKELDELIAELRNEHNVTVLLIEHDMKLVMGISDRIYVVN 228 (255) T ss_pred HCCCHHHHHHHHHHHHH----HCCCEEEECCCCCCCCHHHHHHHHHHHHHHHHCCCCEEEEECCCHHHHHHHCCEEEEEE T ss_conf 67948899999999997----29996998187546999999999999999997159799999273899998699999999 No 239 >PRK10895 putative ABC transporter ATP-binding protein YhbG; Provisional Probab=97.95 E-value=2.4e-05 Score=54.24 Aligned_cols=38 Identities=18% Similarity=0.384 Sum_probs=32.0 Q ss_pred CCEEEEEEEEECCCC-EEEEECCCCCCHHHHHHHHHHHH Q ss_conf 227899998873898-18998899978889999999871 Q gi|255764514|r 8 NIVLIESLDIDFSAG-LSILSGDTGSGKSILLDALILVT 45 (554) Q Consensus 8 Nf~~i~~~~i~f~~G-l~vItGetGaGKS~ildAl~~~l 45 (554) +...++++++++.+| +.+|.||||||||+++.+|.-++ T Consensus 15 ~~~~l~~vsl~i~~Gei~~liGpNGaGKSTLl~~i~Gl~ 53 (241) T PRK10895 15 GRRVVEDVSLTVNSGEIVGLLGPNGAGKTTTFYMVVGIV 53 (241) T ss_pred CEEEEEEEEEEECCCCEEEEECCCCCCHHHHHHHHHCCC T ss_conf 999995207898399799998899986999999996788 No 240 >cd03233 ABC_PDR_domain1 The pleiotropic drug resistance (PDR) family of ATP-binding cassette (ABC) transporters. PDR is a well-described phenomenon occurring in fungi and shares several similarities with processes in bacteria and higher eukaryotes. This PDR subfamily represents domain I of its (ABC-IM)2 organization. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds including sugars, ions, peptides, and more complex organic molecules. The nucleotide-binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins. Probab=97.94 E-value=2.1e-05 Score=54.60 Aligned_cols=35 Identities=31% Similarity=0.439 Sum_probs=30.0 Q ss_pred EEEEEEEECCCC-EEEEECCCCCCHHHHHHHHHHHH Q ss_conf 899998873898-18998899978889999999871 Q gi|255764514|r 11 LIESLDIDFSAG-LSILSGDTGSGKSILLDALILVT 45 (554) Q Consensus 11 ~i~~~~i~f~~G-l~vItGetGaGKS~ildAl~~~l 45 (554) .++++++.+.|| +++|.||||||||+++.+|+-.+ T Consensus 22 vL~~is~~i~~Gei~~llG~nGsGKSTLl~~l~G~~ 57 (202) T cd03233 22 ILKDFSGVVKPGEMVLVLGRPGSGCSTLLKALANRT 57 (202) T ss_pred EEECEEEEECCCEEEEEECCCCCCHHHHHHHHHCCC T ss_conf 997708898098499999899998899999983787 No 241 >PRK13543 cytochrome c biogenesis protein CcmA; Provisional Probab=97.94 E-value=2.2e-05 Score=54.49 Aligned_cols=40 Identities=30% Similarity=0.447 Sum_probs=33.0 Q ss_pred EECCEEEEEEEEECCCC-EEEEECCCCCCHHHHHHHHHHHH Q ss_conf 94227899998873898-18998899978889999999871 Q gi|255764514|r 6 IYNIVLIESLDIDFSAG-LSILSGDTGSGKSILLDALILVT 45 (554) Q Consensus 6 i~Nf~~i~~~~i~f~~G-l~vItGetGaGKS~ildAl~~~l 45 (554) ..+..+++++++.+.+| +.+|+||||||||+++..|+-++ T Consensus 21 ~~~~~vl~~isf~v~~Ge~~~l~GpNGaGKTTLlr~l~Gl~ 61 (214) T PRK13543 21 RNEEPVFGPLDFHVDAGEALLVQGDNGAGKTTLLRVLAGLL 61 (214) T ss_pred ECCEEEEECEEEEECCCCEEEEECCCCCCHHHHHHHHHCCC T ss_conf 79999982638898189899999999987999999997697 No 242 >PTZ00243 ABC transporter; Provisional Probab=97.94 E-value=0.0001 Score=50.10 Aligned_cols=74 Identities=16% Similarity=0.202 Sum_probs=61.3 Q ss_pred HCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCEEEEECHHHHHHHCCCEEEEEE Q ss_conf 06215799999999984366899769980344688879999999999997305939998083798650176179999 Q gi|255764514|r 428 ASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSKKIQLLAVTHAPQVAARADRHFLVYK 504 (554) Q Consensus 428 aSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~~~Qvi~ITH~pqvAa~a~~h~~v~K 504 (554) .|+|++-++.|| -|+.+ .+.+.+++||-=|+|+.+|-..|=+.+++--+++=||+|.|-=.-..-.|.=++..+ T Consensus 1446 lS~GQRQLlcLA--RALLr-r~skILlLDEATAsvD~~TD~lIQ~tIr~~F~~~TVItIAHRL~TI~d~DrIlVLd~ 1519 (1560) T PTZ00243 1446 YSVGQRQLMCMA--RALLK-KGSGFILMDEATANIDPALDRQIQATVMSAFSAYTVITIAHRLHTVAQYDKIIVMDH 1519 (1560) T ss_pred CCHHHHHHHHHH--HHHHC-CCCCEEEEECCCCCCCHHHHHHHHHHHHHHHCCCEEEEEHHHHHHHHHCCEEEEEEC T ss_conf 789999999999--99975-799879987821058989999999999998289989982613746986898999848 No 243 >TIGR02168 SMC_prok_B chromosome segregation protein SMC; InterPro: IPR011890 The SMC (structural maintenance of chromosomes) family of proteins, exist in virtually all organisms including both bacteria and archaea. The SMC proteins are essential for successful chromosome transmission during replication and segregation of the genome in all organisms and form three types of heterodimer (SMC1SMC3, SMC2SMC4, SMC5SMC6), which are core components of large multiprotein complexes. The best known complexes are cohesin, which is responsible for sister-chromatid cohesion, and condensin, which is required for full chromosome condensation in mitosis. SMCs are generally present as single proteins in bacteria, and as at least six distinct proteins in eukaryotes. The proteins range in size from approximately 110 to 170 kDa, and share a five-domain structure, with globular N- and C-terminal (IPR003395 from INTERPRO) domains separated by a long (circa 100 nm or 900 residues) coiled coil segment in the centre of which is a globular ''hinge'' domain, characterised by a set of four highly conserved glycine residues that are typical of flexible regions in a protein. The amino-terminal domain contains a 'Walker A' nucleotide-binding domain (GxxGxGKS/T), which by mutational studies has been shown to be essential in several proteins. The carboxy-terminal domain contains a sequence (the DA-box) that resembles a 'Walker B' motif (XXXXD, where X is any hydrophobic residue), and a LSGG motif with homology to the signature sequence of the ATP-binding cassette (ABC) family of ATPases . All SMC proteins appear to form dimers, either forming homodimers with themselves, as in the case of prokaryotic SMC proteins, or heterodimers between different but related SMC proteins. The dimers are arranged in an antiparallel alignment. This orientation brings the N- and C-terminal globular domains (from either different or identical protamers) together, which unites an ATP binding site (Walker A motif) within the N-terminal domain with a Walker B motif (DA box) within the C-terminal domain, to form a potentially functional ATPase. Protein interaction and microscopy data suggest that SMC dimers form a ring-like structure which might embrace DNA molecules. Non-SMC subunits associate with the SMC amino- and carboxy-terminal domains. The sequence homology within the carboxy-terminal domain is relatively high within the SMC1-SMC4 group, whereas SMC5 and SMC6 show some divergence in both of these sequences. SMCs share not only sequence similarity but also structural similarity with ABC proteins. SMC proteins function together with other proteins in a range of chromosomal transactions, including chromosome condensation, sister-chromatid cohesion, recombination, DNA repair and epigenetic silencing of gene expression . The smc gene is often associated with scpB (IPR005234 from INTERPRO) and scpA genes, where scp stands for segregation and condensation protein. SMC was shown (in Caulobacter crescentus) to be induced early in S phase but present and bound to DNA throughout the cell cycle , , .; GO: 0005515 protein binding, 0005524 ATP binding, 0005694 chromosome. Probab=97.94 E-value=0.0019 Score=41.63 Aligned_cols=171 Identities=19% Similarity=0.270 Sum_probs=138.6 Q ss_pred CCEEEEECCEEE-EEEEEECCCCEEEEECCCCCCHHHHHHHHHHHHCCCC------C--CCCCCCCCC------EEEEEE Q ss_conf 925999422789-9998873898189988999788899999998714732------5--331128972------589999 Q gi|255764514|r 1 MTRLSIYNIVLI-ESLDIDFSAGLSILSGDTGSGKSILLDALILVTGGRG------D--GGLVRRHAE------KGQVVA 65 (554) Q Consensus 1 L~~L~i~Nf~~i-~~~~i~f~~Gl~vItGetGaGKS~ildAl~~~lG~r~------~--~~~Ir~g~~------~a~Ve~ 65 (554) |++|.|..|.+| |.++|+|.+|+|+|+||||||||||+|||.||||..+ + .|+|..|++ .|.|++ T Consensus 2 Lk~l~l~GFKSFaD~t~i~F~~g~TgiVGPNGcGKSNi~DAiRWVLGEqSak~LRg~~M~DVIF~Gs~~Rkp~~~AeV~L 81 (1191) T TIGR02168 2 LKKLELAGFKSFADPTTINFDKGITGIVGPNGCGKSNIVDAIRWVLGEQSAKALRGGKMEDVIFNGSETRKPLSLAEVEL 81 (1191) T ss_pred CCEEEECCCCCCCCCEEEEECCCEEEEECCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCEEECCCCCCCCCCEEEEEE T ss_conf 61357612101353047861785279862799870018999998600334777346899955634887776577006898 Q ss_pred EEECCCCHHHHHHHHHCCCCCCCCEEEEEEEEC-CCCEEEEECCEEEECHHHHHH------HHHHHCCCCCCCHHHHH-- Q ss_conf 997289737888887478988883899999943-897799999988410112221------11000001220000000-- Q gi|255764514|r 66 VFEISHLPALEILFAEANLTLEKHVILRRVQFP-DGRTKAYVNDQVVSVNFMRAV------GSLLIEIHSQHADRSLL-- 136 (554) Q Consensus 66 ~F~~~~~~~~~~~~~~~~~~~~~~~iirR~i~~-~GkS~~~INg~~v~~~~L~~l------~~~lidi~gQ~e~~~Ll-- 136 (554) +|+++++...-.| ....+|.|+|.+.+ +|-|.|||||+||.+.++.+| |..-+.|.+|+.--.++ T Consensus 82 ~fdN~d~~l~~~y------~~y~Ei~itRr~~Rg~GeSeY~iN~~~cRLkDI~dLF~dtGlG~~sysII~QG~I~~i~~a 155 (1191) T TIGR02168 82 VFDNSDGLLPGQY------ADYSEISITRRLYRGDGESEYFINGQPCRLKDIQDLFLDTGLGKRSYSIIEQGKISEIIEA 155 (1191) T ss_pred EEECCCCCCHHHH------CCCCEEEEEEEEEECCCCCEEEECCCCCHHHHHHHHHHHCCCCCCCCEEECCCCHHHHHCC T ss_conf 8855888351211------3677178998887458644045577501377799887322788654323034305565249 Q ss_pred HHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHH Q ss_conf 03678777766300001389999999999999988877665 Q gi|255764514|r 137 DVQGHRKILDSYADIDLSLCELGTLYRHWCCTADALKKYQE 177 (554) Q Consensus 137 ~~~~q~~lLD~~~~~~~~~~~~~~~~~~~~~~~~~l~~l~~ 177 (554) +|...|.|++.-||+..+..+-+...+.+......|.++.+ T Consensus 156 KPeerR~i~EEAAGisKYK~Rk~Et~~kL~~t~~NL~Rl~D 196 (1191) T TIGR02168 156 KPEERRAIFEEAAGISKYKERKKETERKLERTRENLERLED 196 (1191) T ss_pred CHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHH T ss_conf 96899999887213578887799999989999985999999 No 244 >cd03231 ABC_CcmA_heme_exporter CcmA, the ATP-binding component of the bacterial CcmAB transporter. The CCM family is involved in bacterial cytochrome c biogenesis. Cytochrome c maturation in E. coli requires the ccm operon, which encodes eight membrane proteins (CcmABCDEFGH). CcmE is a periplasmic heme chaperone that binds heme covalently and transfers it onto apocytochrome c in the presence of CcmF, CcmG, and CcmH. The CcmAB proteins represent an ABC transporter and the CcmCD proteins participate in heme transfer to CcmE. Probab=97.93 E-value=2.4e-05 Score=54.19 Aligned_cols=38 Identities=32% Similarity=0.477 Sum_probs=31.9 Q ss_pred CCEEEEEEEEECCCC-EEEEECCCCCCHHHHHHHHHHHH Q ss_conf 227899998873898-18998899978889999999871 Q gi|255764514|r 8 NIVLIESLDIDFSAG-LSILSGDTGSGKSILLDALILVT 45 (554) Q Consensus 8 Nf~~i~~~~i~f~~G-l~vItGetGaGKS~ildAl~~~l 45 (554) +-.+++++++.+.+| +.+|+||||||||+++.+|.-++ T Consensus 12 ~~~il~~vs~~i~~Ge~~~l~G~NGsGKSTLlk~i~Gl~ 50 (201) T cd03231 12 GRALFSGLSFTLAAGEALQVTGPNGSGKTTLLRILAGLS 50 (201) T ss_pred CEEEEECCEEEECCCCEEEEECCCCCCHHHHHHHHHCCC T ss_conf 999995307888799599999999999999999996677 No 245 >PRK10982 galactose/methyl galaxtoside transporter ATP-binding protein; Provisional Probab=97.93 E-value=0.00016 Score=48.70 Aligned_cols=96 Identities=19% Similarity=0.296 Sum_probs=70.8 Q ss_pred HHCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHC-CCEEEEECH-HHHHHHCCCEEEEEE Q ss_conf 406215799999999984366899769980344688879999999999997305-939998083-798650176179999 Q gi|255764514|r 427 LASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSKK-IQLLAVTHA-PQVAARADRHFLVYK 504 (554) Q Consensus 427 iaSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~~-~Qvi~ITH~-pqvAa~a~~h~~v~K 504 (554) -+|||++=|+++|-.++. .++.+|+||.=+|++-.+...|.++|+++.+. .=||+|||= +-|+..+|+=+++.+ T Consensus 391 ~LSGGq~QRv~iAraL~~----~p~iLilDEPTsGLD~~~~~~i~~ll~~l~~~G~~il~iSHDl~~~~~~~DRv~vm~~ 466 (491) T PRK10982 391 SLSGGNQQKVIIGRWLLT----QPEILMLDEPTRGIDVGAKFEIYQLIAELAKKDKGIIIISSEMPELLGITDRILVMSN 466 (491) T ss_pred CCCHHHHHHHHHHHHHHH----CCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCEEEEEECCHHHHHHHCCEEEEEEC T ss_conf 499999999999999984----9988999787557999999999999999996899999995858999986999999979 Q ss_pred EECCCCCCEEEEEEEECCHH-HHHHHHHHHHCC Q ss_conf 62168752589999975988-999999998668 Q gi|255764514|r 505 TNKPDDTQRIETYVAVLTPQ-ERREEIARMLAG 536 (554) Q Consensus 505 ~~~~~~~~~~~~~i~~l~~~-~r~~Eiarml~g 536 (554) | + -|...+.. --.++|-|+.+| T Consensus 467 ----G---~---iv~~~~~~~~~~~~~~~~~~~ 489 (491) T PRK10982 467 ----G---L---VAGIVDTKTTTQNEILRLASL 489 (491) T ss_pred ----C---E---EEEEECHHHCCHHHHHHHHHC T ss_conf ----9---9---998978697799999999850 No 246 >PRK10744 phosphate transporter subunit; Provisional Probab=97.93 E-value=3.2e-05 Score=53.36 Aligned_cols=38 Identities=21% Similarity=0.438 Sum_probs=32.5 Q ss_pred CEEEEEEEEECCCC-EEEEECCCCCCHHHHHHHHHHHHC Q ss_conf 27899998873898-189988999788899999998714 Q gi|255764514|r 9 IVLIESLDIDFSAG-LSILSGDTGSGKSILLDALILVTG 46 (554) Q Consensus 9 f~~i~~~~i~f~~G-l~vItGetGaGKS~ildAl~~~lG 46 (554) +..++++++++.+| +++|+||||||||+++..|.-+++ T Consensus 23 ~~aL~~vsl~i~~Ge~~~liG~nGaGKSTLlk~i~gl~~ 61 (257) T PRK10744 23 FHALKNINLDIAKNQVTAFIGPSGCGKSTLLRTFNKMYE 61 (257) T ss_pred EEEECCCEEEECCCCEEEEECCCCCCHHHHHHHHHHHHC T ss_conf 767814289988998999999999819999999987651 No 247 >COG1131 CcmA ABC-type multidrug transport system, ATPase component [Defense mechanisms] Probab=97.92 E-value=1.9e-05 Score=54.82 Aligned_cols=74 Identities=27% Similarity=0.381 Sum_probs=62.1 Q ss_pred HHCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCC--CEEEEECHHHHHHH-CCCEEEEE Q ss_conf 4062157999999999843668997699803446888799999999999973059--39998083798650-17617999 Q gi|255764514|r 427 LASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSKKI--QLLAVTHAPQVAAR-ADRHFLVY 503 (554) Q Consensus 427 iaSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~~~--Qvi~ITH~pqvAa~-a~~h~~v~ 503 (554) -.|||++-|+++|..++ .+| +.+|+||.-+|++-..+..+-+.|+++++.. =|++.||.+.-+.. +| ++.+- T Consensus 136 ~lS~G~kqrl~ia~aL~---~~P-~lliLDEPt~GLDp~~~~~~~~~l~~l~~~g~~tvlissH~l~e~~~~~d-~v~il 210 (293) T COG1131 136 TLSGGMKQRLSIALALL---HDP-ELLILDEPTSGLDPESRREIWELLRELAKEGGVTILLSTHILEEAEELCD-RVIIL 210 (293) T ss_pred HCCHHHHHHHHHHHHHH---CCC-CEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCCEEEEECCCHHHHHHHCC-EEEEE T ss_conf 37988999999999996---699-99999699778799999999999999996799599998388699998689-99999 Q ss_pred EE Q ss_conf 96 Q gi|255764514|r 504 KT 505 (554) Q Consensus 504 K~ 505 (554) +. T Consensus 211 ~~ 212 (293) T COG1131 211 ND 212 (293) T ss_pred EC T ss_conf 89 No 248 >PRK11819 putative ABC transporter ATP-binding protein; Reviewed Probab=97.92 E-value=5.6e-05 Score=51.75 Aligned_cols=33 Identities=27% Similarity=0.465 Sum_probs=28.7 Q ss_pred EEEEEEEEECCCC-EEEEECCCCCCHHHHHHHHH Q ss_conf 7899998873898-18998899978889999999 Q gi|255764514|r 10 VLIESLDIDFSAG-LSILSGDTGSGKSILLDALI 42 (554) Q Consensus 10 ~~i~~~~i~f~~G-l~vItGetGaGKS~ildAl~ 42 (554) .+++++++.+.+| ...|+|+||||||+|+..|+ T Consensus 21 ~lL~~vsl~i~~Ge~vgLvG~NGaGKSTLlriLa 54 (556) T PRK11819 21 QILKDISLSFFPGAKIGVLGLNGAGKSTLLRIMA 54 (556) T ss_pred EEEECCEEEECCCCEEEEECCCCCHHHHHHHHHH T ss_conf 8898818999689899999999971999999984 No 249 >COG1122 CbiO ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism] Probab=97.92 E-value=4.8e-05 Score=52.22 Aligned_cols=74 Identities=24% Similarity=0.296 Sum_probs=61.7 Q ss_pred HCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCC--CEEEEECHHHHHHH-CCCEEEEEE Q ss_conf 062157999999999843668997699803446888799999999999973059--39998083798650-176179999 Q gi|255764514|r 428 ASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSKKI--QLLAVTHAPQVAAR-ADRHFLVYK 504 (554) Q Consensus 428 aSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~~~--Qvi~ITH~pqvAa~-a~~h~~v~K 504 (554) +||||+=|+++|-.++.. +.++||||-=||++......+-+++++|.+.. =+|+|||--.-+.. ||.=|...+ T Consensus 139 LSGGqkqRvaIA~vLa~~----P~iliLDEPta~LD~~~~~~l~~~l~~L~~~~~~tiii~tHd~~~~~~~ad~v~vl~~ 214 (235) T COG1122 139 LSGGQKQRVAIAGVLAMG----PEILLLDEPTAGLDPKGRRELLELLKKLKEEGGKTIIIVTHDLELVLEYADRVVVLDD 214 (235) T ss_pred CCCCCEEEHHHHHHHHCC----CCEEEECCCCCCCCHHHHHHHHHHHHHHHHCCCCEEEEEECCHHHHHHHCCEEEEEEC T ss_conf 697316658866888718----9899974998898978999999999998860797699994747898854889999889 Q ss_pred E Q ss_conf 6 Q gi|255764514|r 505 T 505 (554) Q Consensus 505 ~ 505 (554) - T Consensus 215 G 215 (235) T COG1122 215 G 215 (235) T ss_pred C T ss_conf 9 No 250 >PRK11831 putative ABC transporter ATP-binding protein YrbF; Provisional Probab=97.91 E-value=2.3e-05 Score=54.33 Aligned_cols=38 Identities=21% Similarity=0.418 Sum_probs=31.4 Q ss_pred CCEEEEEEEEECCCC-EEEEECCCCCCHHHHHHHHHHHH Q ss_conf 227899998873898-18998899978889999999871 Q gi|255764514|r 8 NIVLIESLDIDFSAG-LSILSGDTGSGKSILLDALILVT 45 (554) Q Consensus 8 Nf~~i~~~~i~f~~G-l~vItGetGaGKS~ildAl~~~l 45 (554) +...++++++++.+| +++|+||||||||+++..|.-++ T Consensus 20 ~~~vL~~is~~i~~Gei~~iiGpnGsGKSTLlk~i~Gl~ 58 (269) T PRK11831 20 NRCIFDNISLTVPRGKITAIMGPSGIGKTTLLRLIGGQI 58 (269) T ss_pred CEEEEECCEEEECCCCEEEEECCCCCHHHHHHHHHHCCC T ss_conf 989994716688799899999399975999999996798 No 251 >PRK11248 tauB taurine transporter ATP-binding subunit; Provisional Probab=97.91 E-value=2.6e-05 Score=54.01 Aligned_cols=72 Identities=22% Similarity=0.227 Sum_probs=57.7 Q ss_pred HCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHH--CCCEEEEECHH-HHHHHCCCEEEEE Q ss_conf 0621579999999998436689976998034468887999999999999730--59399980837-9865017617999 Q gi|255764514|r 428 ASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSK--KIQLLAVTHAP-QVAARADRHFLVY 503 (554) Q Consensus 428 aSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~--~~Qvi~ITH~p-qvAa~a~~h~~v~ 503 (554) +|||++=|+++|-.++ ..++.+++||.=+|++-.+...+-++|+++.+ ..=|+.|||-- .+...||+=++.. T Consensus 129 LSGGqkQRVaiArAL~----~~P~iLllDEPt~~LD~~~r~~l~~ll~~l~~~~g~Til~vTHdl~ea~~ladrv~vm~ 203 (255) T PRK11248 129 LSGGQRQRVGIARALA----ANPQLLLLDEPFGALDAFTREQMQELLLKLWQETGKQVLLITHDIEEAVFMATELVLLS 203 (255) T ss_pred CCHHHHHHHHHHHHHH----CCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHCCCEEEEECCCHHHHHHHCCEEEEEE T ss_conf 9999999999999997----29999998088777998999999999999999619999998868999999699999982 No 252 >PRK03695 vitamin B12-transporter ATPase; Provisional Probab=97.91 E-value=1.7e-05 Score=55.10 Aligned_cols=39 Identities=28% Similarity=0.528 Sum_probs=31.9 Q ss_pred EEEECCEE---EEEEEEECCCC-EEEEECCCCCCHHHHHHHHH Q ss_conf 99942278---99998873898-18998899978889999999 Q gi|255764514|r 4 LSIYNIVL---IESLDIDFSAG-LSILSGDTGSGKSILLDALI 42 (554) Q Consensus 4 L~i~Nf~~---i~~~~i~f~~G-l~vItGetGaGKS~ildAl~ 42 (554) |.++|... +.+++++..+| +.+|.||||||||+++.+|. T Consensus 2 l~v~nlsv~~~L~~isl~v~~Ge~v~iiGpNGaGKSTLlk~i~ 44 (245) T PRK03695 2 MQLNDVAVSTRLGPLSGEVRAGEILHLVGPNGAGKSTLLARMA 44 (245) T ss_pred EEEECCCCCCCCCCEEEEECCCCEEEEECCCCCHHHHHHHHHH T ss_conf 7997742278050748999599899999789941999999984 No 253 >PRK09493 glnQ glutamine ABC transporter ATP-binding protein; Reviewed Probab=97.91 E-value=2.8e-05 Score=53.74 Aligned_cols=37 Identities=27% Similarity=0.582 Sum_probs=30.9 Q ss_pred CEEEEEEEEECCCC-EEEEECCCCCCHHHHHHHHHHHH Q ss_conf 27899998873898-18998899978889999999871 Q gi|255764514|r 9 IVLIESLDIDFSAG-LSILSGDTGSGKSILLDALILVT 45 (554) Q Consensus 9 f~~i~~~~i~f~~G-l~vItGetGaGKS~ildAl~~~l 45 (554) ...+++++++..+| +++|+||||||||+++.+|.-++ T Consensus 14 ~~~L~dvs~~i~~Ge~~~liG~nGsGKSTll~~i~Gl~ 51 (240) T PRK09493 14 TQVLHNIDLNIDQGEVVVIIGPSGSGKSTLLRCINKLE 51 (240) T ss_pred EEEEECEEEEECCCCEEEEECCCCCHHHHHHHHHHCCC T ss_conf 98881307898799899999999980999999996389 No 254 >cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity. In bacteria and archaea, these transporters usually include an ATP-binding protein and one or two integral membrane proteins. Eukaryote systems of the ABCA subfamily display ABC domains that are quite similar to this family. The ATP-binding domain shows the highest similarity between all members of the ABC transporter family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins. Probab=97.90 E-value=0.00015 Score=48.99 Aligned_cols=72 Identities=26% Similarity=0.313 Sum_probs=58.6 Q ss_pred HCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHC-CCEEEEECHHHHH-HHCCCEEEEE Q ss_conf 06215799999999984366899769980344688879999999999997305-9399980837986-5017617999 Q gi|255764514|r 428 ASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSKK-IQLLAVTHAPQVA-ARADRHFLVY 503 (554) Q Consensus 428 aSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~~-~Qvi~ITH~pqvA-a~a~~h~~v~ 503 (554) +|||++-|+++|..++ ..++.++|||.=+|++-.+...+-++|+++.+. .=||++||....+ ..+|+=+.+. T Consensus 96 LSgG~kqrv~ia~al~----~~p~lllLDEPt~gLD~~~~~~i~~~i~~l~~~g~tvi~~tH~l~~~~~~~dri~vl~ 169 (173) T cd03230 96 LSGGMKQRLALAQALL----HDPELLILDEPTSGLDPESRREFWELLRELKKEGKTILLSSHILEEAERLCDRVAILN 169 (173) T ss_pred CCHHHHHHHHHHHHHH----CCCCEEEECCCCCCCCHHHHHHHHHHHHHHHHCCCEEEEECCCHHHHHHHCCEEEEEE T ss_conf 3989999999999996----4999999908865799999999999999999689999999283899998699999993 No 255 >cd03266 ABC_NatA_sodium_exporter NatA is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled proton or K+ uptake. NatB possess six putative membrane spanning regions at its C-terminus. In B. subtilus, NatAB is inducible by agents such as ethanol and protonophores, which lower the protonmotive force across the membrane. The closest sequence similarity to NatA is exhibited by DrrA of the two-component daunomycin- and doxorubicin-efflux system. Hence, the functional NatAB is presumably assembled with two copies of a single ATP-binding protein and a single intergral membrane protein. Probab=97.90 E-value=0.00014 Score=49.23 Aligned_cols=74 Identities=24% Similarity=0.256 Sum_probs=58.6 Q ss_pred HHCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHH-CCCEEEEECHHHHH-HHCCCEEEEEE Q ss_conf 40621579999999998436689976998034468887999999999999730-59399980837986-50176179999 Q gi|255764514|r 427 LASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSK-KIQLLAVTHAPQVA-ARADRHFLVYK 504 (554) Q Consensus 427 iaSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~-~~Qvi~ITH~pqvA-a~a~~h~~v~K 504 (554) -+|||.+-|+++|..++ ..++.+|+||.=+|++-.....+-++|+++.+ ..=||.+||.-.-| ..+|+-+.+.+ T Consensus 136 ~LS~G~kqrv~la~al~----~~P~lliLDEPt~gLD~~~~~~i~~~l~~l~~~g~til~~sH~l~e~~~l~dri~vl~~ 211 (218) T cd03266 136 GFSTGMRQKVAIARALV----HDPPVLLLDEPTTGLDVMATRALREFIRQLRALGKCILFSTHIMQEVERLCDRVVVLHR 211 (218) T ss_pred HCCCHHHHHHHHHHHHH----CCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCEEEEECCCHHHHHHHCCEEEEEEC T ss_conf 27826889999999986----69989999798767699999999999999985799999989878999996999999989 No 256 >cd03226 ABC_cobalt_CbiO_domain2 Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota. The transition metal cobalt is an essential component of many enzymes and must be transported into cells in appropriate amounts when needed. The CbiMNQO family ABC transport system is involved in cobalt transport in association with the cobalamin (vitamin B12) biosynthetic pathways. Most cobalt (Cbi) transport systems possess a separate CbiN component, the cobalt-binding periplasmic protein, and they are encoded by the conserved gene cluster cbiMNQO. Both the CbiM and CbiQ proteins are integral cytoplasmic membrane proteins, and the CbiO protein has the linker peptide and the Walker A and B motifs commonly found in the ATPase components of the ABC-type transport systems. Probab=97.90 E-value=2.2e-05 Score=54.45 Aligned_cols=37 Identities=30% Similarity=0.556 Sum_probs=32.1 Q ss_pred CEEEEEEEEECCCC-EEEEECCCCCCHHHHHHHHHHHH Q ss_conf 27899998873898-18998899978889999999871 Q gi|255764514|r 9 IVLIESLDIDFSAG-LSILSGDTGSGKSILLDALILVT 45 (554) Q Consensus 9 f~~i~~~~i~f~~G-l~vItGetGaGKS~ildAl~~~l 45 (554) -..++++++++.+| +.+|+||||||||+++.+|+-++ T Consensus 13 ~~vL~~vsl~i~~Gei~~iiG~nGaGKSTLl~~i~Gl~ 50 (205) T cd03226 13 TEILDDLSLDLYAGEIIALTGKNGAGKTTLAKILAGLI 50 (205) T ss_pred CEEEEEEEEEECCCCEEEEECCCCCCHHHHHHHHHCCC T ss_conf 97864037888699899998899998999999995685 No 257 >cd03271 ABC_UvrA_II The excision repair protein UvrA domain II; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion. Recognition and cleavage of the damaged DNA is a multistep ATP-dependent reaction that requires the UvrA, UvrB, and UvrC proteins. Both UvrA and UvrB are ATPases, with UvrA having two ATP binding sites, which have the characteristic signature of the family of ABC proteins and UvrB having one ATP binding site that is structurally related to that of helicases. Probab=97.90 E-value=1.2e-05 Score=56.08 Aligned_cols=32 Identities=34% Similarity=0.720 Sum_probs=27.9 Q ss_pred EEEEEEECCCC-EEEEECCCCCCHHHHHHHHHH Q ss_conf 99998873898-189988999788899999998 Q gi|255764514|r 12 IESLDIDFSAG-LSILSGDTGSGKSILLDALIL 43 (554) Q Consensus 12 i~~~~i~f~~G-l~vItGetGaGKS~ildAl~~ 43 (554) .+++++++.+| +++|+||||||||+++.++.+ T Consensus 11 L~~vsl~i~~G~~~aIiG~sGsGKSTLl~~~L~ 43 (261) T cd03271 11 LKNIDVDIPLGVLTCVTGVSGSGKSSLINDTLY 43 (261) T ss_pred CCCEEEEECCCCEEEEECCCCCCHHHHHHHHHH T ss_conf 778588988999999987999869999999988 No 258 >cd03257 ABC_NikE_OppD_transporters The ABC transporter subfamily specific for the transport of dipeptides, oligopeptides (OppD), and nickel (NikDE). The NikABCDE system of E. coli belongs to this family and is composed of the periplasmic binding protein NikA, two integral membrane components (NikB and NikC), and two ATPase (NikD and NikE). The NikABCDE transporter is synthesized under anaerobic conditions to meet the increased demand for nickel resulting from hydrogenase synthesis. The molecular mechanism of nickel uptake in many bacteria and most archaea is not known. Many other members of this ABC family are also involved in the uptake of dipeptides and oligopeptides. The oligopeptide transport system (Opp) is a five-component ABC transport composed of a membrane-anchored substrate binding proteins (SRP), OppA, two transmembrane proteins, OppB and OppC, and two ATP-binding domains, OppD and OppF. Probab=97.90 E-value=2.8e-05 Score=53.80 Aligned_cols=36 Identities=28% Similarity=0.435 Sum_probs=30.5 Q ss_pred EEEEEEEEECCCC-EEEEECCCCCCHHHHHHHHHHHH Q ss_conf 7899998873898-18998899978889999999871 Q gi|255764514|r 10 VLIESLDIDFSAG-LSILSGDTGSGKSILLDALILVT 45 (554) Q Consensus 10 ~~i~~~~i~f~~G-l~vItGetGaGKS~ildAl~~~l 45 (554) ..++++++++.+| +.+|+||||||||+++.+|.-++ T Consensus 19 ~~L~dIsl~i~~Ge~~~iiG~sGsGKSTLl~~i~Gl~ 55 (228) T cd03257 19 KALDDVSFSIKKGETLGLVGESGSGKSTLARAILGLL 55 (228) T ss_pred EEEECEEEEECCCCEEEEECCCCCHHHHHHHHHHCCC T ss_conf 9985607898699899999999986999999997289 No 259 >cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth. EF-3 stimulates the binding of the EF-1: GTP: aa-tRNA ternary complex to the ribosomal A site by facilitated release of the deacylated tRNA from the E site. The reaction requires ATP hydrolysis. EF-3 contains two ATP nucleotide binding sequence (NBS) motifs. NBSI is sufficient for the intrinsic ATPase activity. NBSII is essential for the ribosome-stimulated functions. Probab=97.90 E-value=3.5e-05 Score=53.14 Aligned_cols=42 Identities=24% Similarity=0.321 Sum_probs=34.8 Q ss_pred EEEECCEEEEEEEEECCCC-EEEEECCCCCCHHHHHHHHHHHH Q ss_conf 9994227899998873898-18998899978889999999871 Q gi|255764514|r 4 LSIYNIVLIESLDIDFSAG-LSILSGDTGSGKSILLDALILVT 45 (554) Q Consensus 4 L~i~Nf~~i~~~~i~f~~G-l~vItGetGaGKS~ildAl~~~l 45 (554) .+..+-.+++++++++.+| ..+|+||||||||+++..|+-.+ T Consensus 8 ~~y~~~~vl~~is~~i~~ge~~~l~G~NGsGKTTl~~~l~G~~ 50 (144) T cd03221 8 KTYGGKLLLKDISLTINPGDRIGLVGRNGAGKSTLLKLIAGEL 50 (144) T ss_pred EEECCEEEEEEEEEEECCCCEEEEECCCCCCHHHHHHHHHCCC T ss_conf 9999999996348998799999999899984999999984898 No 260 >PRK11264 putative amino-acid ABC transporter ATP-binding protein YecC; Provisional Probab=97.89 E-value=2.7e-05 Score=53.82 Aligned_cols=72 Identities=25% Similarity=0.369 Sum_probs=58.2 Q ss_pred HCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHC-CCEEEEECHHHHHHH-CCCEEEEE Q ss_conf 06215799999999984366899769980344688879999999999997305-939998083798650-17617999 Q gi|255764514|r 428 ASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSKK-IQLLAVTHAPQVAAR-ADRHFLVY 503 (554) Q Consensus 428 aSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~~-~Qvi~ITH~pqvAa~-a~~h~~v~ 503 (554) +|||++=|+++|-.++ ..++.+++||.=+|++-.+...+-+.|+++.+. .=+|+|||-...|+. ||+=++.. T Consensus 143 LSGGq~QRvaiAraL~----~~P~iLllDEPTs~LD~~~~~~i~~~l~~l~~~g~tii~vtHdl~~~~~~adrv~vm~ 216 (248) T PRK11264 143 LSGGQQQRVAIARALA----MRPEVILFDEPTSALDPELVGEVLNTIRQLAQEKRTMVIVTHEMSFARDVADRAIFMD 216 (248) T ss_pred CCHHHHHHHHHHHHCC----CCCCEEEECCCCCCCCHHHHHHHHHHHHHHHHCCCCEEEEECCHHHHHHHCCEEEEEE T ss_conf 8999988999876314----7999999879876589999999999999999769928999899999999699899998 No 261 >PRK11701 phnK phosphonates transport ATP-binding protein; Provisional Probab=97.89 E-value=0.00013 Score=49.38 Aligned_cols=37 Identities=30% Similarity=0.397 Sum_probs=31.4 Q ss_pred CEEEEEEEEECCCC-EEEEECCCCCCHHHHHHHHHHHH Q ss_conf 27899998873898-18998899978889999999871 Q gi|255764514|r 9 IVLIESLDIDFSAG-LSILSGDTGSGKSILLDALILVT 45 (554) Q Consensus 9 f~~i~~~~i~f~~G-l~vItGetGaGKS~ildAl~~~l 45 (554) ...++++++++.+| +.+|+||||||||+++.+|+-.+ T Consensus 19 ~~aL~~Vs~~v~~GEi~~iiG~nGaGKSTLl~~i~G~~ 56 (258) T PRK11701 19 RKGCRDVSFDLYPGEVLGIVGESGSGKTTLLNALSARL 56 (258) T ss_pred EEEECCEEEEECCCCEEEEECCCCCCHHHHHHHHHCCC T ss_conf 78871227788799799998889988999999985678 No 262 >TIGR01842 type_I_sec_PrtD type I secretion system ATPase; InterPro: IPR010128 Type I protein secretion is a system in some Gram-negative bacteria to export proteins (often proteases) across both inner and outer membranes to the extracellular medium. This is one of three proteins of the type I secretion apparatus. Targeted proteins are not cleaved at the N terminus, but rather carry signals located toward the extreme C terminus to direct type I secretion.; GO: 0005524 ATP binding, 0015031 protein transport, 0016021 integral to membrane. Probab=97.89 E-value=6e-05 Score=51.58 Aligned_cols=69 Identities=29% Similarity=0.439 Sum_probs=52.3 Q ss_pred HCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHH-CCCEEEEECHHHHHHHCCCEE Q ss_conf 0621579999999998436689976998034468887999999999999730-593999808379865017617 Q gi|255764514|r 428 ASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSK-KIQLLAVTHAPQVAARADRHF 500 (554) Q Consensus 428 aSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~-~~Qvi~ITH~pqvAa~a~~h~ 500 (554) +|||-+=||.||= |+ +..+-++|+||-+||++-+==..+.+-|+.+-+ ..=|++|||-|-+=.++|+=+ T Consensus 467 LSGGQRQRIaLAR--Al--yG~P~lvvLDEPNsNLD~~GE~AL~~Ai~~lK~rg~tvv~itHRp~lL~~vDkIl 536 (556) T TIGR01842 467 LSGGQRQRIALAR--AL--YGDPKLVVLDEPNSNLDEEGEQALANAIKALKARGITVVVITHRPSLLGLVDKIL 536 (556) T ss_pred CCCHHHHHHHHHH--HH--HCCCEEEEECCCCCCCCHHHHHHHHHHHHHHHHCCCEEEEEECHHHHHHHHHHHH T ss_conf 8614689999999--87--1798378732889876617899999999999867972899841068999999999 No 263 >PTZ00265 multidrug resistance protein (mdr1); Provisional Probab=97.88 E-value=0.0001 Score=50.00 Aligned_cols=74 Identities=19% Similarity=0.307 Sum_probs=61.6 Q ss_pred HHCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHH--CCCEEEEECHHHHHHHCCCEEEEEE Q ss_conf 40621579999999998436689976998034468887999999999999730--5939998083798650176179999 Q gi|255764514|r 427 LASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSK--KIQLLAVTHAPQVAARADRHFLVYK 504 (554) Q Consensus 427 iaSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~--~~Qvi~ITH~pqvAa~a~~h~~v~K 504 (554) -+|||++=|++||=. +. ..++.+++||-=++|+.++-..|=+-|+++.+ ++-+|+|.|--.--..+|.=+++.+ T Consensus 1359 nLSgGQKQrIaIARA--LL--R~pkILLLDEATSaLD~eSE~~VQ~aL~~~~~~~~rTvI~IAHRLsTI~~aD~I~Vld~ 1434 (1467) T PTZ00265 1359 SLSGGQKQRIAIARA--LL--REPKILLLDEATSSLDSNSEKLIEKTIVDIKDKADKTIITIAHRIASIKRSDKIVVFNN 1434 (1467) T ss_pred CCCHHHHHHHHHHHH--HH--HCCCEEEEECCHHCCCHHHHHHHHHHHHHHHHCCCCEEEEEHHHHHHHHHCCEEEEEEC T ss_conf 369999999999999--97--64998999680205898999999999999885289989985642778996898999947 No 264 >cd03290 ABCC_SUR1_N The SUR domain 1. The sulfonylurea receptor SUR is an ATP transporter of the ABCC/MRP family with tandem ATPase binding domains. Unlike other ABC proteins, it has no intrinsic transport function, neither active nor passive, but associates with the potassium channel proteins Kir6.1 or Kir6.2 to form the ATP-sensitive potassium (K(ATP)) channel. Within the channel complex, SUR serves as a regulatory subunit that fine-tunes the gating of Kir6.x in response to alterations in cellular metabolism. It constitutes a major pharmaceutical target as it binds numerous drugs, K(ATP) channel openers and blockers, capable of up- or down-regulating channel activity. Probab=97.88 E-value=2.1e-05 Score=54.51 Aligned_cols=36 Identities=31% Similarity=0.602 Sum_probs=30.3 Q ss_pred CCEEEEEEEEECCCC-EEEEECCCCCCHHHHHHHHHH Q ss_conf 227899998873898-189988999788899999998 Q gi|255764514|r 8 NIVLIESLDIDFSAG-LSILSGDTGSGKSILLDALIL 43 (554) Q Consensus 8 Nf~~i~~~~i~f~~G-l~vItGetGaGKS~ildAl~~ 43 (554) +...++++++.+.+| +++|+|+||||||+|+.+|.- T Consensus 13 ~~~vL~~inl~i~~Ge~~~IvG~sGsGKSTLl~~l~g 49 (218) T cd03290 13 GLATLSNINIRIPTGQLTMIVGQVGCGKSSLLLAILG 49 (218) T ss_pred CCEEEECEEEEECCCCEEEEECCCCCCHHHHHHHHHC T ss_conf 9905647699986999999999999809999999855 No 265 >PRK09700 D-allose transporter ATP-binding protein; Provisional Probab=97.88 E-value=0.00032 Score=46.82 Aligned_cols=74 Identities=23% Similarity=0.346 Sum_probs=60.7 Q ss_pred HHCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHC-CCEEEEECH-HHHHHHCCCEEEEEE Q ss_conf 406215799999999984366899769980344688879999999999997305-939998083-798650176179999 Q gi|255764514|r 427 LASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSKK-IQLLAVTHA-PQVAARADRHFLVYK 504 (554) Q Consensus 427 iaSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~~-~Qvi~ITH~-pqvAa~a~~h~~v~K 504 (554) -+|||++=|+++|-.++. .++.+||||.=+|++-.+...|.++|+++.+. .-||+|||- .-|+..+|+=+++.. T Consensus 409 ~LSGGq~Qrv~iAraL~~----~p~lLilDEPT~GlD~~~~~~i~~li~~l~~~G~tvl~ishdl~ev~~~~DRi~Vm~~ 484 (510) T PRK09700 409 ELSGGNQQKVLISKWLCC----CPEVIIFDEPTRGIDVGAKAEIYKVMRQLADDGKVILMVSSELPEIITVCDRIAVFCE 484 (510) T ss_pred HCCHHHHHHHHHHHHHHH----CCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCEEEEEECCHHHHHHHCCEEEEEEC T ss_conf 599999999999999985----9988999797558999999999999999996899999990758999986999999989 No 266 >cd03256 ABC_PhnC_transporter ABC-type phosphate/phosphonate transport system. Phosphonates are a class of organophosphorus compounds characterized by a chemically stable carbon-to-phosphorus (C-P) bond. Phosphonates are widespread among naturally occurring compounds in all kingdoms of wildlife, but only procaryotic microorganisms are able to cleave this bond. Certain bacteria such as E. coli can use alkylphosphonates as a phosphorus source. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins. Probab=97.88 E-value=1.8e-05 Score=55.06 Aligned_cols=37 Identities=27% Similarity=0.448 Sum_probs=32.2 Q ss_pred CEEEEEEEEECCCC-EEEEECCCCCCHHHHHHHHHHHH Q ss_conf 27899998873898-18998899978889999999871 Q gi|255764514|r 9 IVLIESLDIDFSAG-LSILSGDTGSGKSILLDALILVT 45 (554) Q Consensus 9 f~~i~~~~i~f~~G-l~vItGetGaGKS~ildAl~~~l 45 (554) ...++++++++.+| +++|.||||||||+++..|.-++ T Consensus 14 ~~~L~~isl~i~~Ge~~~iiGpsGsGKSTLl~~i~gl~ 51 (241) T cd03256 14 KKALKDVSLSINPGEFVALIGPSGAGKSTLLRCLNGLV 51 (241) T ss_pred CEEEECCEEEECCCCEEEEECCCCCHHHHHHHHHHCCC T ss_conf 88997838899999899999999833999999997499 No 267 >cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea. Only very few species lack representatives of the siderophore family transporters. The E. coli BtuCD protein is an ABC transporter mediating vitamin B12 uptake. The two ATP-binding cassettes (BtuD) are in close contact with each other, as are the two membrane-spanning subunits (BtuC); this arrangement is distinct from that observed for the E. coli lipid flippase MsbA. The BtuC subunits provide 20 transmembrane helices grouped around a translocation pathway that is closed to the cytoplasm by a gate region, whereas the dimer arrangement of the BtuD subunits resembles the ATP-bound form of the Rad50 DNA repair enzyme. A prominent cytoplasmic loop of BtuC forms the contact region with the ATP-binding cassette and represent a conserved motif among the ABC transporters. Probab=97.88 E-value=3.4e-05 Score=53.16 Aligned_cols=41 Identities=27% Similarity=0.419 Sum_probs=34.3 Q ss_pred EEECCEEEEEEEEECCCC-EEEEECCCCCCHHHHHHHHHHHH Q ss_conf 994227899998873898-18998899978889999999871 Q gi|255764514|r 5 SIYNIVLIESLDIDFSAG-LSILSGDTGSGKSILLDALILVT 45 (554) Q Consensus 5 ~i~Nf~~i~~~~i~f~~G-l~vItGetGaGKS~ildAl~~~l 45 (554) +..+-..++++++++.+| +++|+||||||||+++.+|+=.+ T Consensus 8 ~y~~~~il~~is~~i~~Ge~~~liG~nGsGKTTLl~~i~G~~ 49 (180) T cd03214 8 GYGGRTVLDDLSLSIEAGEIVGILGPNGAGKSTLLKTLAGLL 49 (180) T ss_pred EECCEEEEECEEEEECCCCEEEEECCCCCCHHHHHHHHHCCC T ss_conf 989999880437788699799999899988999999995798 No 268 >PRK13542 consensus Probab=97.88 E-value=3.2e-05 Score=53.35 Aligned_cols=37 Identities=32% Similarity=0.498 Sum_probs=32.0 Q ss_pred CEEEEEEEEECCCC-EEEEECCCCCCHHHHHHHHHHHH Q ss_conf 27899998873898-18998899978889999999871 Q gi|255764514|r 9 IVLIESLDIDFSAG-LSILSGDTGSGKSILLDALILVT 45 (554) Q Consensus 9 f~~i~~~~i~f~~G-l~vItGetGaGKS~ildAl~~~l 45 (554) -.+++++++++.+| +.+|+||||||||+++..|+-.+ T Consensus 31 ~~il~~isl~i~~Gei~~liGpNGaGKTTLlk~l~Gll 68 (224) T PRK13542 31 RAVFRGIDISLAPGDLLQVMGPNGSGKTSLLRVLSGLM 68 (224) T ss_pred EEEEECCEEEECCCCEEEEECCCCCCHHHHHHHHHCCC T ss_conf 99884616787599799999999999999999995797 No 269 >PRK11629 lolD lipoprotein transporter ATP-binding subunit; Provisional Probab=97.87 E-value=3.4e-05 Score=53.20 Aligned_cols=35 Identities=29% Similarity=0.506 Sum_probs=29.4 Q ss_pred EEEEEEEECCCC-EEEEECCCCCCHHHHHHHHHHHH Q ss_conf 899998873898-18998899978889999999871 Q gi|255764514|r 11 LIESLDIDFSAG-LSILSGDTGSGKSILLDALILVT 45 (554) Q Consensus 11 ~i~~~~i~f~~G-l~vItGetGaGKS~ildAl~~~l 45 (554) .++++++++.+| +.+|+||||||||+++..|.-+. T Consensus 24 ~l~~vs~~i~~GE~v~iiG~sGsGKSTLl~~i~Gl~ 59 (233) T PRK11629 24 VLHNVSFSIGEGEMMAIVGSSGSGKSTLLHLLGGLD 59 (233) T ss_pred EEECEEEEECCCCEEEEECCCCCCHHHHHHHHHCCC T ss_conf 984628998899899999999940999999996699 No 270 >PRK10762 D-ribose transporter ATP binding protein; Provisional Probab=97.87 E-value=0.0005 Score=45.50 Aligned_cols=74 Identities=19% Similarity=0.294 Sum_probs=59.4 Q ss_pred HHCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHC-CCEEEEECHHHH-HHHCCCEEEEEE Q ss_conf 406215799999999984366899769980344688879999999999997305-939998083798-650176179999 Q gi|255764514|r 427 LASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSKK-IQLLAVTHAPQV-AARADRHFLVYK 504 (554) Q Consensus 427 iaSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~~-~Qvi~ITH~pqv-Aa~a~~h~~v~K 504 (554) -+|||++=|+++|-.++. .++.+|+||.=+|++-.+...|.++|+++.+. .-||+|||=... +..+|+=++... T Consensus 395 ~LSGGq~Qrv~iAraL~~----~p~lLilDEPT~GLD~~~~~~i~~ll~~l~~~G~til~isHDl~~v~~~aDRv~vm~~ 470 (501) T PRK10762 395 LLSGGNQQKVAIARGLMT----RPKVLILDEPTRGVDVGAKKEIYQLINQFKADGLSIILVSSEMPEVLGMSDRIIVMHE 470 (501) T ss_pred CCCHHHHHHHHHHHHHHC----CCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCEEEEEECCHHHHHHHCCEEEEEEC T ss_conf 099999999999999972----9988999798668999999999999999996799999991868999986999999969 No 271 >cd03224 ABC_TM1139_LivF_branched LivF (TM1139) is part of the LIV-I bacterial ABC-type two-component transport system that imports neutral, branched-chain amino acids. The E. coli branched-chain amino acid transporter comprises a heterodimer of ABC transporters (LivF and LivG), a heterodimer of six-helix TM domains (LivM and LivH), and one of two alternative soluble periplasmic substrate binding proteins (LivK or LivJ). ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. Probab=97.87 E-value=3.4e-05 Score=53.19 Aligned_cols=39 Identities=21% Similarity=0.403 Sum_probs=32.0 Q ss_pred EECCEEEEEEEEECCCC-EEEEECCCCCCHHHHHHHHHHH Q ss_conf 94227899998873898-1899889997888999999987 Q gi|255764514|r 6 IYNIVLIESLDIDFSAG-LSILSGDTGSGKSILLDALILV 44 (554) Q Consensus 6 i~Nf~~i~~~~i~f~~G-l~vItGetGaGKS~ildAl~~~ 44 (554) ..+...++++++++.+| +.+|.||||||||+++.+|+-+ T Consensus 10 yg~~~~L~~vs~~v~~Gei~~liG~nGaGKSTLl~~i~Gl 49 (222) T cd03224 10 YGKSQILFGVSLTVPEGEIVALLGRNGAGKTTLLKTIMGL 49 (222) T ss_pred ECCEEEECCEEEEECCCCEEEEECCCCCCHHHHHHHHHCC T ss_conf 8999998140899889989999999998599999999779 No 272 >PRK11614 livF leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Probab=97.87 E-value=3.9e-05 Score=52.83 Aligned_cols=36 Identities=28% Similarity=0.511 Sum_probs=30.6 Q ss_pred CCEEEEEEEEECCCC-EEEEECCCCCCHHHHHHHHHH Q ss_conf 227899998873898-189988999788899999998 Q gi|255764514|r 8 NIVLIESLDIDFSAG-LSILSGDTGSGKSILLDALIL 43 (554) Q Consensus 8 Nf~~i~~~~i~f~~G-l~vItGetGaGKS~ildAl~~ 43 (554) ++..++++++++.+| +++|.||||||||+++..|+= T Consensus 17 ~~~~L~~isl~i~~Gei~~liG~NGaGKSTLl~~i~G 53 (237) T PRK11614 17 KIQALHEVSLHINQGEIVTLIGANGAGKTTLLGTLCG 53 (237) T ss_pred CEEEEEEEEEEECCCCEEEEECCCCCCHHHHHHHHHC T ss_conf 9888811278986997999987999759999999967 No 273 >cd03265 ABC_DrrA DrrA is the ATP-binding protein component of a bacterial exporter complex that confers resistance to the antibiotics daunorubicin and doxorubicin. In addition to DrrA, the complex includes an integral membrane protein called DrrB. DrrA belongs to the ABC family of transporters and shares sequence and functional similarities with a protein found in cancer cells called P-glycoprotein. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region in addition to the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins. Probab=97.87 E-value=0.00018 Score=48.45 Aligned_cols=74 Identities=20% Similarity=0.233 Sum_probs=59.8 Q ss_pred HHCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCC--CEEEEECHHHHHHHCCCEEEEEE Q ss_conf 4062157999999999843668997699803446888799999999999973059--39998083798650176179999 Q gi|255764514|r 427 LASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSKKI--QLLAVTHAPQVAARADRHFLVYK 504 (554) Q Consensus 427 iaSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~~~--Qvi~ITH~pqvAa~a~~h~~v~K 504 (554) -+|||.+-|+++|..++ ..++.++|||.=+|++-.....+-+.|+++.+.. =||.+||.-..|..--.++.|-+ T Consensus 131 ~LS~G~kqrv~ia~Al~----~~P~lliLDEPt~gLDp~~~~~i~~~i~~l~~~~g~tiilssH~l~eve~l~dri~il~ 206 (220) T cd03265 131 TYSGGMRRRLEIARSLV----HRPEVLFLDEPTIGLDPQTRAHVWEYIEKLKEEFGMTILLTTHYMEEAEQLCDRVAIID 206 (220) T ss_pred HCCHHHHHHHHHHHHHH----CCCCEEEECCCCCCCCHHHHHHHHHHHHHHHHHCCCEEEEECCCHHHHHHHCCEEEEEE T ss_conf 47999999999999985----69998998088668899999999999999998389799998888899998699999997 No 274 >cd03225 ABC_cobalt_CbiO_domain1 Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota. The transition metal cobalt is an essential component of many enzymes and must be transported into cells in appropriate amounts when needed. This ABC transport system of the CbiMNQO family is involved in cobalt transport in association with the cobalamin (vitamin B12) biosynthetic pathways. Most of cobalt (Cbi) transport systems possess a separate CbiN component, the cobalt-binding periplasmic protein, and they are encoded by the conserved gene cluster cbiMNQO. Both the CbiM and CbiQ proteins are integral cytoplasmic membrane proteins, and the CbiO protein has the linker peptide and the Walker A and B motifs commonly found in the ATPase components of the ABC-type transport systems. Probab=97.87 E-value=2.7e-05 Score=53.80 Aligned_cols=37 Identities=27% Similarity=0.451 Sum_probs=31.8 Q ss_pred CEEEEEEEEECCCC-EEEEECCCCCCHHHHHHHHHHHH Q ss_conf 27899998873898-18998899978889999999871 Q gi|255764514|r 9 IVLIESLDIDFSAG-LSILSGDTGSGKSILLDALILVT 45 (554) Q Consensus 9 f~~i~~~~i~f~~G-l~vItGetGaGKS~ildAl~~~l 45 (554) ...++++++++.+| +++|+||||||||+++..|+-++ T Consensus 14 ~~~L~~vsl~i~~Gei~~iiG~nGaGKSTLlk~i~Gl~ 51 (211) T cd03225 14 RPALDDISLTIKKGEFVLIVGPNGSGKSTLLRLLNGLL 51 (211) T ss_pred CEEEEEEEEEECCCCEEEEECCCCCCHHHHHHHHHCCC T ss_conf 25775317888499799998899998999999996467 No 275 >TIGR03522 GldA_ABC_ATP gliding motility-associated ABC transporter ATP-binding subunit GldA. Members of this protein family are exclusive to the Bacteroidetes phylum (previously Cytophaga-Flavobacteria-Bacteroides). GldA is an ABC transporter ATP-binding protein (pfam00005) linked to a type of rapid surface gliding motility found in certain Bacteroidetes, such as Flavobacterium johnsoniae and Cytophaga hutchinsonii. Knockouts of GldA abolish the gliding phenotype. Gliding motility appears closely linked to chitin utilization in the model species Flavobacterium johnsoniae. Bacteroidetes with members of this protein family appear to have all of the genes associated with gliding motility. Probab=97.87 E-value=0.00016 Score=48.84 Aligned_cols=38 Identities=16% Similarity=0.267 Sum_probs=31.5 Q ss_pred CCEEEEEEEEECCCC-EEEEECCCCCCHHHHHHHHHHHH Q ss_conf 227899998873898-18998899978889999999871 Q gi|255764514|r 8 NIVLIESLDIDFSAG-LSILSGDTGSGKSILLDALILVT 45 (554) Q Consensus 8 Nf~~i~~~~i~f~~G-l~vItGetGaGKS~ildAl~~~l 45 (554) ++..+++++++..+| +..+.||||||||+++..|+-++ T Consensus 14 ~~~al~~vsf~v~~Gei~gllGpNGAGKTTl~~~l~Gl~ 52 (301) T TIGR03522 14 TQNALDEVSFEAQKGRIVGFLGPNGAGKSTTMKIITGYL 52 (301) T ss_pred CEEEECCEEEEECCCCEEEEECCCCCCHHHHHHHHHCCC T ss_conf 999973606788598199999999981999999996795 No 276 >PRK11153 metN DL-methionine transporter ATP-binding subunit; Provisional Probab=97.87 E-value=0.00015 Score=48.86 Aligned_cols=35 Identities=26% Similarity=0.496 Sum_probs=29.5 Q ss_pred EEEEEEEEECCCC-EEEEECCCCCCHHHHHHHHHHH Q ss_conf 7899998873898-1899889997888999999987 Q gi|255764514|r 10 VLIESLDIDFSAG-LSILSGDTGSGKSILLDALILV 44 (554) Q Consensus 10 ~~i~~~~i~f~~G-l~vItGetGaGKS~ildAl~~~ 44 (554) .-.++++++..+| +..|+|+||||||+++.+|+.+ T Consensus 19 ~AL~~Vsl~I~~Gei~giIG~SGaGKSTLlr~i~gL 54 (343) T PRK11153 19 QALNNVSLHVPAGQIYGVIGASGAGKSTLIRCVNLL 54 (343) T ss_pred EEEECEEEEECCCCEEEEECCCCCHHHHHHHHHHCC T ss_conf 999661889989989999999998699999999659 No 277 >cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion. Recognition and cleavage of the damaged DNA is a multistep ATP-dependent reaction that requires the UvrA, UvrB, and UvrC proteins. Both UvrA and UvrB are ATPases, with UvrA having two ATP binding sites, which have the characteristic signature of the family of ABC proteins, and UvrB having one ATP binding site that is structurally related to that of helicases. Probab=97.86 E-value=1.9e-05 Score=54.79 Aligned_cols=43 Identities=30% Similarity=0.497 Sum_probs=34.9 Q ss_pred EEECCEEEEEEEEECCCC-EEEEECCCCCCHHHHHHHHHHHHCC Q ss_conf 994227899998873898-1899889997888999999987147 Q gi|255764514|r 5 SIYNIVLIESLDIDFSAG-LSILSGDTGSGKSILLDALILVTGG 47 (554) Q Consensus 5 ~i~Nf~~i~~~~i~f~~G-l~vItGetGaGKS~ildAl~~~lG~ 47 (554) .=.|.-.++++++++.+| +++|+||||||||+++.++....+. T Consensus 4 ~g~~~~aL~~isl~i~~Ge~~~iiG~nGsGKSTLl~~~~~~~~~ 47 (176) T cd03238 4 SGANVHNLQNLDVSIPLNVLVVVTGVSGSGKSTLVNEGLYASGK 47 (176) T ss_pred CCCCEECCCCEEEEECCCCEEEEECCCCCCHHHHHHHHHHHHHC T ss_conf 77653546754878889989999999999899999988876103 No 278 >PRK13648 cbiO cobalt transporter ATP-binding subunit; Provisional Probab=97.86 E-value=2.7e-05 Score=53.88 Aligned_cols=34 Identities=24% Similarity=0.503 Sum_probs=29.4 Q ss_pred EEEEEEEECCCC-EEEEECCCCCCHHHHHHHHHHH Q ss_conf 899998873898-1899889997888999999987 Q gi|255764514|r 11 LIESLDIDFSAG-LSILSGDTGSGKSILLDALILV 44 (554) Q Consensus 11 ~i~~~~i~f~~G-l~vItGetGaGKS~ildAl~~~ 44 (554) .++++++++.+| +++|+|+||||||+++..|+-+ T Consensus 24 ~L~~is~~i~~Ge~vaiiG~sGsGKSTLl~ll~Gl 58 (269) T PRK13648 24 TLKDVSFNIPKGQWTSIVGHNGSGKSTIAKLMIGI 58 (269) T ss_pred EEEEEEEEECCCCEEEEECCCCCCHHHHHHHHHCC T ss_conf 56645899859989999999999799999999649 No 279 >PRK11247 ssuB aliphatic sulfonates transport ATP-binding subunit; Provisional Probab=97.86 E-value=3.1e-05 Score=53.47 Aligned_cols=38 Identities=32% Similarity=0.531 Sum_probs=32.0 Q ss_pred CCEEEEEEEEECCCC-EEEEECCCCCCHHHHHHHHHHHH Q ss_conf 227899998873898-18998899978889999999871 Q gi|255764514|r 8 NIVLIESLDIDFSAG-LSILSGDTGSGKSILLDALILVT 45 (554) Q Consensus 8 Nf~~i~~~~i~f~~G-l~vItGetGaGKS~ildAl~~~l 45 (554) +...++++++++.+| +++|+||||||||+++..|.-+. T Consensus 24 ~~~~L~dIs~~I~~GEiv~LiG~nGaGKSTLlr~i~Gl~ 62 (257) T PRK11247 24 ERTVLNQLDLHIPAGQFVAVVGRSGCGKSTLLRLLAGLE 62 (257) T ss_pred CEEEECCEEEEECCCCEEEEECCCCCHHHHHHHHHHCCC T ss_conf 988982407588799899999899888999999996589 No 280 >COG4987 CydC ABC-type transport system involved in cytochrome bd biosynthesis, fused ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Probab=97.85 E-value=0.00013 Score=49.46 Aligned_cols=78 Identities=29% Similarity=0.355 Sum_probs=66.0 Q ss_pred CCCCCHHHHHHCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCEEEEECHHHHHHHCC Q ss_conf 99831135440621579999999998436689976998034468887999999999999730593999808379865017 Q gi|255764514|r 418 GENPGPLMKLASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSKKIQLLAVTHAPQVAARAD 497 (554) Q Consensus 418 g~~~~pl~kiaSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~~~Qvi~ITH~pqvAa~a~ 497 (554) |+.-.++ ||||.=|++||=.+. .+.|..++||.-.|++..|...|=..|.+..++.-+|.|||---=....| T Consensus 469 ge~G~~L----SGGE~rRLAlAR~LL----~dapl~lLDEPTegLD~~TE~~vL~ll~~~~~~kTll~vTHrL~~le~~d 540 (573) T COG4987 469 GEGGRRL----SGGERRRLALARALL----HDAPLWLLDEPTEGLDPITERQVLALLFEHAEGKTLLMVTHRLRGLERMD 540 (573) T ss_pred CCCCCCC----CCHHHHHHHHHHHHH----CCCCEEEECCCCCCCCHHHHHHHHHHHHHHHCCCEEEEEECCCCCHHHCC T ss_conf 2599747----813899999999997----07986884488666786439999999999845985999964542176568 Q ss_pred CEEEEE Q ss_conf 617999 Q gi|255764514|r 498 RHFLVY 503 (554) Q Consensus 498 ~h~~v~ 503 (554) +=.++. T Consensus 541 rIivl~ 546 (573) T COG4987 541 RIIVLD 546 (573) T ss_pred EEEEEE T ss_conf 779987 No 281 >PRK11147 ABC transporter ATPase component; Reviewed Probab=97.84 E-value=9e-05 Score=50.42 Aligned_cols=39 Identities=28% Similarity=0.481 Sum_probs=32.2 Q ss_pred EEEECC-------EEEEEEEEECCCC-EEEEECCCCCCHHHHHHHHH Q ss_conf 999422-------7899998873898-18998899978889999999 Q gi|255764514|r 4 LSIYNI-------VLIESLDIDFSAG-LSILSGDTGSGKSILLDALI 42 (554) Q Consensus 4 L~i~Nf-------~~i~~~~i~f~~G-l~vItGetGaGKS~ildAl~ 42 (554) |+|+|+ .+++++++.+.+| ..+|+|+||||||+|+..|+ T Consensus 4 i~~~nls~s~g~~~ll~~vsl~I~~Ge~vgLVG~NGsGKSTLl~iL~ 50 (632) T PRK11147 4 ISMHNAWLSFSDAPLLDNAELHIEDNERVCLVGRNGAGKSTLMKILS 50 (632) T ss_pred EEEEEEEEEECCEEEEECCEEEECCCCEEEEECCCCCHHHHHHHHHH T ss_conf 99813999999926898625999899899999999987999999983 No 282 >PRK11300 livG leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Probab=97.84 E-value=3.9e-05 Score=52.79 Aligned_cols=36 Identities=17% Similarity=0.451 Sum_probs=30.7 Q ss_pred CCEEEEEEEEECCCC-EEEEECCCCCCHHHHHHHHHH Q ss_conf 227899998873898-189988999788899999998 Q gi|255764514|r 8 NIVLIESLDIDFSAG-LSILSGDTGSGKSILLDALIL 43 (554) Q Consensus 8 Nf~~i~~~~i~f~~G-l~vItGetGaGKS~ildAl~~ 43 (554) ++..+++++++..+| +.+|.||||||||+++.+|.= T Consensus 17 ~~~al~~vs~~v~~Gei~~liGpnGaGKSTL~~~i~G 53 (255) T PRK11300 17 GLLAVNNVNLEVREQEVVSLIGPNGAGKTTVFNCLTG 53 (255) T ss_pred CEEEECCEEEEECCCCEEEEECCCCCCHHHHHHHHHC T ss_conf 9998804088989997999998999649999999967 No 283 >TIGR03608 L_ocin_972_ABC putative bacteriocin export ABC transporter, lactococcin 972 group. A gene pair with a fairly wide distribution consists of a polypeptide related to the lactococcin 972 (see TIGR01653) and multiple-membrane-spanning putative immunity protein (see TIGR01654). This model represents a small clade within the ABC transporters that regularly are found adjacent to these bacteriocin system gene pairs and are likely serve as export proteins. Probab=97.84 E-value=2.9e-05 Score=53.61 Aligned_cols=40 Identities=28% Similarity=0.580 Sum_probs=33.1 Q ss_pred EECCEEEEEEEEECCCC-EEEEECCCCCCHHHHHHHHHHHH Q ss_conf 94227899998873898-18998899978889999999871 Q gi|255764514|r 6 IYNIVLIESLDIDFSAG-LSILSGDTGSGKSILLDALILVT 45 (554) Q Consensus 6 i~Nf~~i~~~~i~f~~G-l~vItGetGaGKS~ildAl~~~l 45 (554) ..+...++++++++.+| +.+|+||+|||||++|..|+.+. T Consensus 8 yg~~~vL~~vsl~i~~Ge~~~i~GpSGsGKSTLL~~i~gl~ 48 (206) T TIGR03608 8 FGDKTILDDLNLTIEKGKMVAIVGESGSGKSTLLNIIGLLE 48 (206) T ss_pred ECCEEEECCEEEEECCCCEEEEECCCCCCHHHHHHHHHCCC T ss_conf 89999975807798699899998799970999999997599 No 284 >COG1245 Predicted ATPase, RNase L inhibitor (RLI) homolog [General function prediction only] Probab=97.84 E-value=7.2e-05 Score=51.06 Aligned_cols=73 Identities=19% Similarity=0.272 Sum_probs=56.3 Q ss_pred HCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCC--EEEEECHHHHHHHCCCEEEEEE Q ss_conf 0621579999999998436689976998034468887999999999999730593--9998083798650176179999 Q gi|255764514|r 428 ASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSKKIQ--LLAVTHAPQVAARADRHFLVYK 504 (554) Q Consensus 428 aSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~~~Q--vi~ITH~pqvAa~a~~h~~v~K 504 (554) +||||+-|++.|. +++ .++..|++||--|.++-+--..|++.++....+.. .++|-|=--+.-+-..-+.|.. T Consensus 456 LSGGELQRvaIaa--~L~--reADlYllDEPSA~LDvEqR~~vakvIRR~~e~~~kta~vVdHDi~~~dyvsDr~ivF~ 530 (591) T COG1245 456 LSGGELQRVAIAA--ALS--READLYLLDEPSAYLDVEQRIIVAKVIRRFIENNEKTALVVDHDIYMIDYVSDRLIVFE 530 (591) T ss_pred CCCHHHHHHHHHH--HHC--CCCCEEEECCCHHHCCHHHHHHHHHHHHHHHHCCCCEEEEEECCEEHHHHHHCEEEEEE T ss_conf 7732588999999--865--65677886584343068999999999999986067538999530004335411278970 No 285 >cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity. In bacteria and archaea, these transporters usually include an ATP-binding protein and one or two integral membrane proteins. Eukaryote systems of the ABCA subfamily display ABC domains that are quite similar to this family. The ATP-binding domain shows the highest similarity between all members of the ABC transporter family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins. Probab=97.84 E-value=4.4e-05 Score=52.45 Aligned_cols=39 Identities=18% Similarity=0.372 Sum_probs=32.8 Q ss_pred ECCEEEEEEEEECCCC-EEEEECCCCCCHHHHHHHHHHHH Q ss_conf 4227899998873898-18998899978889999999871 Q gi|255764514|r 7 YNIVLIESLDIDFSAG-LSILSGDTGSGKSILLDALILVT 45 (554) Q Consensus 7 ~Nf~~i~~~~i~f~~G-l~vItGetGaGKS~ildAl~~~l 45 (554) .+...++++++++.+| +.+|.||||||||+++..|+-.+ T Consensus 11 g~~~~L~~vsl~i~~Gei~gl~G~NGaGKSTLl~~i~Gl~ 50 (173) T cd03230 11 GKKTALDDISLTVEKGEIYGLLGPNGAGKTTLIKIILGLL 50 (173) T ss_pred CCEEEEECEEEEECCCCEEEEECCCCCCHHHHHHHHHCCC T ss_conf 9999982208788799399998789979999999997685 No 286 >PRK10619 histidine/lysine/arginine/ornithine transporter subunit; Provisional Probab=97.83 E-value=3.1e-05 Score=53.49 Aligned_cols=37 Identities=24% Similarity=0.484 Sum_probs=31.2 Q ss_pred CEEEEEEEEECCCC-EEEEECCCCCCHHHHHHHHHHHH Q ss_conf 27899998873898-18998899978889999999871 Q gi|255764514|r 9 IVLIESLDIDFSAG-LSILSGDTGSGKSILLDALILVT 45 (554) Q Consensus 9 f~~i~~~~i~f~~G-l~vItGetGaGKS~ildAl~~~l 45 (554) ...++++++++.+| +.+|.||||||||+++.+|+.+. T Consensus 18 ~~vl~~isl~i~~Gei~~iiG~sGsGKSTLl~~i~gl~ 55 (257) T PRK10619 18 HEVLKGVSLQANAGDVISIIGSSGSGKSTFLRCINFLE 55 (257) T ss_pred EEEECCCEEEECCCCEEEEECCCCCHHHHHHHHHHCCC T ss_conf 88873606688799799999899981999999996599 No 287 >cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain. They export degradative enzymes by using a type I protein secretion system and lack an N-terminal signal peptide, but contain a C-terminal secretion signal. The Type I secretion apparatus is made up of three components, an ABC transporter, a membrane fusion protein (MFP), and an outer membrane protein (OMP). For the HlyA transporter complex, HlyB (ABC transporter) and HlyD (MFP) reside in the inner membrane of E. coli. The OMP component is TolC, which is thought to interact with the MFP to form a continuous channel across the periplasm from the cytoplasm to the exterior. HlyB belongs to the family of ABC transporters, which are ubiquitous, ATP-dependent transmembrane pumps or channels. The spectrum of transport substra Probab=97.83 E-value=2.4e-05 Score=54.22 Aligned_cols=35 Identities=23% Similarity=0.424 Sum_probs=29.5 Q ss_pred EEEEEEEECCCC-EEEEECCCCCCHHHHHHHHHHHH Q ss_conf 899998873898-18998899978889999999871 Q gi|255764514|r 11 LIESLDIDFSAG-LSILSGDTGSGKSILLDALILVT 45 (554) Q Consensus 11 ~i~~~~i~f~~G-l~vItGetGaGKS~ildAl~~~l 45 (554) .++++++++.+| +++|+|+||||||+++..|.-.+ T Consensus 17 vL~~i~l~i~~G~~vaIvG~sGsGKSTLl~ll~gl~ 52 (173) T cd03246 17 VLRNVSFSIEPGESLAIIGPSGSGKSTLARLILGLL 52 (173) T ss_pred CEECEEEEECCCCEEEEECCCCCHHHHHHHHHHCCC T ss_conf 454769998599999999999980999999996666 No 288 >PRK10418 nikD nickel transporter ATP-binding protein; Provisional Probab=97.83 E-value=3.6e-05 Score=53.06 Aligned_cols=43 Identities=28% Similarity=0.517 Sum_probs=34.0 Q ss_pred EEEEECCE------EEEEEEEECCCC-EEEEECCCCCCHHHHHHHHHHHH Q ss_conf 59994227------899998873898-18998899978889999999871 Q gi|255764514|r 3 RLSIYNIV------LIESLDIDFSAG-LSILSGDTGSGKSILLDALILVT 45 (554) Q Consensus 3 ~L~i~Nf~------~i~~~~i~f~~G-l~vItGetGaGKS~ildAl~~~l 45 (554) .|.|+|+. .++++++++.+| +.+|+||||||||+++-++.-++ T Consensus 4 ~lEirnl~~~~~~~vL~~Isl~v~~Ge~~aiiG~SGsGKStl~k~llgll 53 (254) T PRK10418 4 QIELRNIALQAAQPLVHGVSLTLQRGRVLALVGGSGSGKSLTCAAALGIL 53 (254) T ss_pred CEEECCEEEECCCEEEECEEEEECCCCEEEEECCCCCHHHHHHHHHHCCC T ss_conf 58982608989970886607289899999999999878999999995799 No 289 >TIGR03269 met_CoM_red_A2 methyl coenzyme M reductase system, component A2. The enzyme that catalyzes the final step in methanogenesis, methyl coenzyme M reductase, contains alpha, beta, and gamma chains. In older literature, the complex of alpha, beta, and gamma chains was termed component C, while this single chain protein was termed methyl coenzyme M reductase system component A2. Probab=97.83 E-value=0.00022 Score=47.83 Aligned_cols=89 Identities=21% Similarity=0.251 Sum_probs=63.5 Q ss_pred HHCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHH--CCCEEEEECHHH-HHHHCCCEEEEE Q ss_conf 40621579999999998436689976998034468887999999999999730--593999808379-865017617999 Q gi|255764514|r 427 LASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSK--KIQLLAVTHAPQ-VAARADRHFLVY 503 (554) Q Consensus 427 iaSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~--~~Qvi~ITH~pq-vAa~a~~h~~v~ 503 (554) -+|||++=|+++|-.++ ..+..+||||.=+|++-.+...+.+.|.++.+ ..-||+|||=.. ++..+|+=++.. T Consensus 427 ~LSGGq~QRvaiAraL~----~~P~vlilDEPT~glD~~~~~~i~~~l~~~~~~~g~tvi~iShDl~~~~~~~dRv~vm~ 502 (520) T TIGR03269 427 ELSEGERHRVALAQVLI----KEPRIVILDEPTGTMDPITKVDVTHSILKAREEMEQTFIIVSHDMDFVLDVCDRAALMR 502 (520) T ss_pred HCCHHHHHHHHHHHHHH----HCCCEEEEECCHHHHHHHHHHHHHHHHHHHHHHCCCEEEEECCCHHHHHHHCCEEEEEE T ss_conf 18999999999999999----79898999386011338999999999999998329899997788899998699999997 Q ss_pred EEECCCCCCEEEEEEEECCHHHHHHH Q ss_conf 96216875258999997598899999 Q gi|255764514|r 504 KTNKPDDTQRIETYVAVLTPQERREE 529 (554) Q Consensus 504 K~~~~~~~~~~~~~i~~l~~~~r~~E 529 (554) . | + -+...+.++=.+| T Consensus 503 ~----G---~---iv~~g~~~ei~~e 518 (520) T TIGR03269 503 D----G---K---IVKIGDPEEIVEE 518 (520) T ss_pred C----C---E---EEEEECHHHHHHC T ss_conf 9----9---9---9999878998327 No 290 >cd03249 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) is a mitochondrial ATP-binding cassette protein involved in iron homeostasis and one of four ABC transporters expressed in the mitochondrial inner membrane, the other three being MDL1(ABC7), MDL2, and ATM1. In fact, the yeast MDL1 (multidrug resistance-like protein 1) and MDL2 (multidrug resistance-like protein 2) transporters are also included in this CD. MDL1 is an ATP-dependent permease that acts as a high-copy suppressor of ATM1 and is thought to have a role in resistance to oxidative stress. Interestingly, subfamily B is more closely related to the carboxyl-terminal component of subfamily C than the two halves of ABCC molecules are with one another. Probab=97.83 E-value=2.8e-05 Score=53.75 Aligned_cols=35 Identities=26% Similarity=0.545 Sum_probs=29.6 Q ss_pred CCEEEEEEEEECCCC-EEEEECCCCCCHHHHHHHHH Q ss_conf 227899998873898-18998899978889999999 Q gi|255764514|r 8 NIVLIESLDIDFSAG-LSILSGDTGSGKSILLDALI 42 (554) Q Consensus 8 Nf~~i~~~~i~f~~G-l~vItGetGaGKS~ildAl~ 42 (554) +...++++++.+.+| +.+|+|+||||||+|+..|. T Consensus 15 ~~~vL~~isl~i~~G~~iaIvG~sGsGKSTLl~ll~ 50 (238) T cd03249 15 DVPILKGLSLTIPPGKTVALVGSSGCGKSTVVSLLE 50 (238) T ss_pred CCEEECCEEEEECCCCEEEEECCCCCCHHHHHHHHH T ss_conf 995222558997699999999999998999999982 No 291 >cd03218 ABC_YhbG The ABC transporters belonging to the YhbG family are similar to members of the Mj1267_LivG family, which is involved in the transport of branched-chain amino acids. The genes yhbG and yhbN are located in a single operon and may function together in cell envelope during biogenesis. YhbG is the putative ATP-binding cassette component and YhbN is the putative periplasmic-binding protein. Depletion of each gene product leads to growth arrest, irreversible cell damage and loss of viability in E. coli. The YhbG homolog (NtrA) is essential in Rhizobium meliloti, a symbiotic nitrogen-fixing bacterium. Probab=97.82 E-value=4.3e-05 Score=52.55 Aligned_cols=39 Identities=15% Similarity=0.306 Sum_probs=32.4 Q ss_pred ECCEEEEEEEEECCCC-EEEEECCCCCCHHHHHHHHHHHH Q ss_conf 4227899998873898-18998899978889999999871 Q gi|255764514|r 7 YNIVLIESLDIDFSAG-LSILSGDTGSGKSILLDALILVT 45 (554) Q Consensus 7 ~Nf~~i~~~~i~f~~G-l~vItGetGaGKS~ildAl~~~l 45 (554) .++..+++++++..+| +.+|.||||||||+++..|+-.+ T Consensus 11 g~~~~l~~vs~~v~~Gei~~llGpNGAGKSTll~~i~Gl~ 50 (232) T cd03218 11 GKRKVVNGVSLSVKQGEIVGLLGPNGAGKTTTFYMIVGLV 50 (232) T ss_pred CCEEEECCEEEEECCCCEEEEECCCCCCHHHHHHHHHCCC T ss_conf 9999882606798999599999999961999999997799 No 292 >cd03295 ABC_OpuCA_Osmoprotection OpuCA is a the ATP binding component of a bacterial solute transporter that serves a protective role to cells growing in a hyperosmolar environment. ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition, to the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins. Probab=97.82 E-value=0.00022 Score=47.85 Aligned_cols=72 Identities=26% Similarity=0.304 Sum_probs=59.5 Q ss_pred HCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHH--CCCEEEEECHHHHHH-HCCCEEEEE Q ss_conf 0621579999999998436689976998034468887999999999999730--593999808379865-017617999 Q gi|255764514|r 428 ASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSK--KIQLLAVTHAPQVAA-RADRHFLVY 503 (554) Q Consensus 428 aSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~--~~Qvi~ITH~pqvAa-~a~~h~~v~ 503 (554) +|||++=|+++|-.++ ..+..+++||.=++++-.+...+-+.|+++-+ +.=+|+|||-+..|. +||+=.+.. T Consensus 136 LSGGqkQRvaiARAl~----~~P~ilLlDEP~saLD~~~~~~i~~~l~~l~~~~~~T~i~vTHd~~ea~~~aDri~vm~ 210 (242) T cd03295 136 LSGGQQQRVGVARALA----ADPPLLLMDEPFGALDPITRDQLQEEFKRLQQELGKTIVFVTHDIDEAFRLADRIAIMK 210 (242) T ss_pred CCHHHHHHHHHHHHHH----CCCCEEEECCCCCCCCHHHHHHHHHHHHHHHHHHCCEEEEECCCHHHHHHHCCEEEEEE T ss_conf 8999999999999996----29999998187654698999999999999999759999999989999999699899998 No 293 >cd03296 ABC_CysA_sulfate_importer Part of the ABC transporter complex cysAWTP involved in sulfate import. Responsible for energy coupling to the transport system. The complex is composed of two ATP-binding proteins (cysA), two transmembrane proteins (cysT and cysW), and a solute-binding protein (cysP). ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins. Probab=97.82 E-value=3.5e-05 Score=53.09 Aligned_cols=74 Identities=23% Similarity=0.326 Sum_probs=59.6 Q ss_pred HHCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHH--CCCEEEEECHHHHHHHCCCEEEEEE Q ss_conf 40621579999999998436689976998034468887999999999999730--5939998083798650176179999 Q gi|255764514|r 427 LASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSK--KIQLLAVTHAPQVAARADRHFLVYK 504 (554) Q Consensus 427 iaSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~--~~Qvi~ITH~pqvAa~a~~h~~v~K 504 (554) -+|||++=|+++|-.++. +| ..+++||.=++++-.+...+-+.|+++.+ +.=+|.|||-+..|..=..+..|-+ T Consensus 136 eLSGGq~QRVaiARAl~~---~P-~vlllDEP~s~LD~~~~~~i~~~l~~l~~e~~~T~i~vTHd~~~a~~laDri~vm~ 211 (239) T cd03296 136 QLSGGQRQRVALARALAV---EP-KVLLLDEPFGALDAKVRKELRRWLRRLHDELHVTTVFVTHDQEEALEVADRVVVMN 211 (239) T ss_pred HCCHHHHHHHHHHHHHHC---CC-CEEEECCCCCCCCHHHHHHHHHHHHHHHHHHCCEEEEECCCHHHHHHHCCEEEEEE T ss_conf 699989899999998764---99-98997388664699999999999999999859989999889999999699999998 No 294 >cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome. The peroxisomal membrane forms a permeability barrier for a wide variety of metabolites required for and formed during fatty acid beta-oxidation. To communicate with the cytoplasm and mitochondria, peroxisomes need dedicated proteins to transport such hydrophilic molecules across their membranes. X-linked adrenoleukodystrophy (X-ALD) is caused by mutations in the ALD gene, which encodes ALDP (adrenoleukodystrophy protein ), a peroxisomal integral membrane protein that is a member of the ATP-binding cassette (ABC) transporter protein family. The disease is characterized by a striking and unpredictable variation in phenotypic expression. Phenotypes include the rapidly progressive childhood cerebral form (CCALD), the milder adult form, adrenomyeloneuropathy (AMN), and variants without neurologic involvement (i.e. asympt Probab=97.82 E-value=3.1e-05 Score=53.41 Aligned_cols=33 Identities=36% Similarity=0.686 Sum_probs=29.5 Q ss_pred EEEEEEEEECCCC-EEEEECCCCCCHHHHHHHHH Q ss_conf 7899998873898-18998899978889999999 Q gi|255764514|r 10 VLIESLDIDFSAG-LSILSGDTGSGKSILLDALI 42 (554) Q Consensus 10 ~~i~~~~i~f~~G-l~vItGetGaGKS~ildAl~ 42 (554) .+++++++++.+| +.+|+|+||||||+++.+|+ T Consensus 15 ~il~~isl~i~~Ge~v~i~G~sGsGKSTLl~~l~ 48 (166) T cd03223 15 VLLKDLSFEIKPGDRLLITGPSGTGKSSLFRALA 48 (166) T ss_pred EEEEEEEEEECCCCEEEEECCCCCCHHHHHHHHC T ss_conf 8894458898899999999589998899999986 No 295 >cd03250 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C. This family is also known as MRP (mulrtidrug resisitance-associated protein). Some of the MRP members have five additional transmembrane segments in their N-terminas, but the function of these additional membrane-spanning domains is not clear. The MRP was found in the multidrug-resisting lung cancer cell in which p-glycoprotein was not overexpressed. MRP exports glutathione by drug stimulation, as well as, certain substrates in conjugated forms with anions, such as glutathione, glucuronate, and sulfate. Probab=97.82 E-value=2.8e-05 Score=53.71 Aligned_cols=32 Identities=38% Similarity=0.698 Sum_probs=29.0 Q ss_pred EEEEEEEECCCC-EEEEECCCCCCHHHHHHHHH Q ss_conf 899998873898-18998899978889999999 Q gi|255764514|r 11 LIESLDIDFSAG-LSILSGDTGSGKSILLDALI 42 (554) Q Consensus 11 ~i~~~~i~f~~G-l~vItGetGaGKS~ildAl~ 42 (554) .++++++.+.+| +++|+|+||||||+|+..|. T Consensus 20 vL~~isl~i~~Ge~~~IvG~sGsGKSTLl~~i~ 52 (204) T cd03250 20 TLKDINLEVPKGELVAIVGPVGSGKSSLLSALL 52 (204) T ss_pred EEEEEEEEECCCCEEEEECCCCCCHHHHHHHHC T ss_conf 252148997699899999999985899999981 No 296 >PRK10982 galactose/methyl galaxtoside transporter ATP-binding protein; Provisional Probab=97.82 E-value=0.00062 Score=44.90 Aligned_cols=38 Identities=24% Similarity=0.503 Sum_probs=31.6 Q ss_pred CCEEEEEEEEECCCC-EEEEECCCCCCHHHHHHHHHHHH Q ss_conf 227899998873898-18998899978889999999871 Q gi|255764514|r 8 NIVLIESLDIDFSAG-LSILSGDTGSGKSILLDALILVT 45 (554) Q Consensus 8 Nf~~i~~~~i~f~~G-l~vItGetGaGKS~ildAl~~~l 45 (554) +....+++++++.+| +.+|+||||||||+++.+|.-++ T Consensus 10 ~~~aL~~vsl~i~~Gei~~liG~nGsGKSTL~~~l~Gl~ 48 (491) T PRK10982 10 GVKALDNVNLKVRPHSIHALMGENGAGKSTLLKCLFGIY 48 (491) T ss_pred CEEEECCEEEEECCCCEEEEECCCCCCHHHHHHHHHCCC T ss_conf 999885638899899699998999981999999995698 No 297 >PRK13636 cbiO cobalt transporter ATP-binding subunit; Provisional Probab=97.82 E-value=2.9e-05 Score=53.68 Aligned_cols=36 Identities=25% Similarity=0.505 Sum_probs=30.2 Q ss_pred EEEEEEEEECCCC-EEEEECCCCCCHHHHHHHHHHHH Q ss_conf 7899998873898-18998899978889999999871 Q gi|255764514|r 10 VLIESLDIDFSAG-LSILSGDTGSGKSILLDALILVT 45 (554) Q Consensus 10 ~~i~~~~i~f~~G-l~vItGetGaGKS~ildAl~~~l 45 (554) ..+++++++..+| +++|.||||||||+++..|+-++ T Consensus 20 ~aL~~isl~I~~Ge~~aiiG~NGaGKSTLl~~i~Gll 56 (285) T PRK13636 20 HALKGININIKKGEVTAILGGNGAGKSTLFQNLNGIL 56 (285) T ss_pred EEEEEEEEEECCCCEEEEECCCCCHHHHHHHHHHCCC T ss_conf 8876137898799899999999980999999996598 No 298 >cd03296 ABC_CysA_sulfate_importer Part of the ABC transporter complex cysAWTP involved in sulfate import. Responsible for energy coupling to the transport system. The complex is composed of two ATP-binding proteins (cysA), two transmembrane proteins (cysT and cysW), and a solute-binding protein (cysP). ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins. Probab=97.81 E-value=0.00016 Score=48.85 Aligned_cols=38 Identities=32% Similarity=0.589 Sum_probs=32.2 Q ss_pred CCEEEEEEEEECCCC-EEEEECCCCCCHHHHHHHHHHHH Q ss_conf 227899998873898-18998899978889999999871 Q gi|255764514|r 8 NIVLIESLDIDFSAG-LSILSGDTGSGKSILLDALILVT 45 (554) Q Consensus 8 Nf~~i~~~~i~f~~G-l~vItGetGaGKS~ildAl~~~l 45 (554) ++..++++++++.+| +.+|+||||||||+++..|.-+. T Consensus 14 ~~~~l~~is~~v~~Ge~~~iiGpSGsGKSTll~~i~Gl~ 52 (239) T cd03296 14 DFVALDDVSLDIPSGELVALLGPSGSGKTTLLRLIAGLE 52 (239) T ss_pred CEEEECCCEEEECCCCEEEEECCCCCHHHHHHHHHHCCC T ss_conf 989986638698899899999999977999999997699 No 299 >PRK13646 cbiO cobalt transporter ATP-binding subunit; Provisional Probab=97.81 E-value=2.8e-05 Score=53.78 Aligned_cols=35 Identities=31% Similarity=0.566 Sum_probs=30.5 Q ss_pred EEEEEEEECCCC-EEEEECCCCCCHHHHHHHHHHHH Q ss_conf 899998873898-18998899978889999999871 Q gi|255764514|r 11 LIESLDIDFSAG-LSILSGDTGSGKSILLDALILVT 45 (554) Q Consensus 11 ~i~~~~i~f~~G-l~vItGetGaGKS~ildAl~~~l 45 (554) .++++++++.+| +++|+|+||||||+++..|+-++ T Consensus 22 aL~~vsl~I~~Ge~~aiiG~nGsGKSTLl~~l~GLl 57 (286) T PRK13646 22 AIHDVNTEFEQGKYYAIVGQTGSGKSTLIQNINALL 57 (286) T ss_pred EEECEEEEECCCCEEEEECCCCCHHHHHHHHHHCCC T ss_conf 662417798699899999999981999999997078 No 300 >PRK13647 cbiO cobalt transporter ATP-binding subunit; Provisional Probab=97.81 E-value=3.4e-05 Score=53.18 Aligned_cols=35 Identities=26% Similarity=0.391 Sum_probs=29.0 Q ss_pred EEEEEEEECCCC-EEEEECCCCCCHHHHHHHHHHHH Q ss_conf 899998873898-18998899978889999999871 Q gi|255764514|r 11 LIESLDIDFSAG-LSILSGDTGSGKSILLDALILVT 45 (554) Q Consensus 11 ~i~~~~i~f~~G-l~vItGetGaGKS~ildAl~~~l 45 (554) .++++++++.+| +++|+||||||||+++..|+-++ T Consensus 20 aL~~vs~~i~~Ge~~aiiG~NGsGKSTLl~~l~Gl~ 55 (273) T PRK13647 20 ALDGVSLVIPEGSKTAILGPNGAGKSTLLLHLNGIY 55 (273) T ss_pred EEEEEEEEECCCCEEEEECCCCCHHHHHHHHHHCCC T ss_conf 988117898899899999999975999999996698 No 301 >KOG0057 consensus Probab=97.81 E-value=0.00011 Score=49.79 Aligned_cols=84 Identities=23% Similarity=0.279 Sum_probs=68.0 Q ss_pred ECCCCCCCCHHHHHHCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCEEEEECHHHHH Q ss_conf 12789983113544062157999999999843668997699803446888799999999999973059399980837986 Q gi|255764514|r 414 QTNRGENPGPLMKLASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSKKIQLLAVTHAPQVA 493 (554) Q Consensus 414 s~n~g~~~~pl~kiaSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~~~Qvi~ITH~pqvA 493 (554) +++.|+.-. -+||||+=|+++|=.++ +.+|.++|||.-+.++-+|-..+=+++.....+.-+|+|-|---.+ T Consensus 478 ~T~VGerG~----~LSGGekQrvslaRa~l----Kda~Il~~DEaTS~LD~~TE~~i~~~i~~~~~~rTvI~IvH~l~ll 549 (591) T KOG0057 478 QTLVGERGL----MLSGGEKQRVSLARAFL----KDAPILLLDEATSALDSETEREILDMIMDVMSGRTVIMIVHRLDLL 549 (591) T ss_pred HHHHHHCCC----CCCCCHHHHHHHHHHHH----CCCCEEEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEEEECCHHH T ss_conf 326753444----25640678999999984----5898688637653236566999999998751797699999630347 Q ss_pred HHCCCEEEEEEE Q ss_conf 501761799996 Q gi|255764514|r 494 ARADRHFLVYKT 505 (554) Q Consensus 494 a~a~~h~~v~K~ 505 (554) ...|.=+.+.+- T Consensus 550 ~~~DkI~~l~nG 561 (591) T KOG0057 550 KDFDKIIVLDNG 561 (591) T ss_pred HCCCEEEEEECC T ss_conf 508889999788 No 302 >PRK10771 thiQ thiamine transporter ATP-binding subunit; Provisional Probab=97.80 E-value=6.2e-05 Score=51.49 Aligned_cols=42 Identities=26% Similarity=0.438 Sum_probs=31.2 Q ss_pred EEEECCE-EEE----EEEEECCCC-EEEEECCCCCCHHHHHHHHHHHH Q ss_conf 9994227-899----998873898-18998899978889999999871 Q gi|255764514|r 4 LSIYNIV-LIE----SLDIDFSAG-LSILSGDTGSGKSILLDALILVT 45 (554) Q Consensus 4 L~i~Nf~-~i~----~~~i~f~~G-l~vItGetGaGKS~ildAl~~~l 45 (554) |.++|+- .|+ +++++..+| +.+|+||||||||+++.+|.-++ T Consensus 2 i~~~nls~~Y~~~~~~isl~i~~GE~v~iiG~nGaGKSTLl~~i~Gll 49 (233) T PRK10771 2 LKLTDITWLYHHLPMRFTLTVERGEQVAILGPSGAGKSTLLNLIAGFL 49 (233) T ss_pred EEEEEEEEEECCEEEEEEEEECCCCEEEEECCCCCHHHHHHHHHHCCC T ss_conf 699979999899876278898899899999999981999999996599 No 303 >PRK13644 cbiO cobalt transporter ATP-binding subunit; Provisional Probab=97.80 E-value=3.2e-05 Score=53.35 Aligned_cols=36 Identities=28% Similarity=0.319 Sum_probs=31.1 Q ss_pred EEEEEEEEECCCC-EEEEECCCCCCHHHHHHHHHHHH Q ss_conf 7899998873898-18998899978889999999871 Q gi|255764514|r 10 VLIESLDIDFSAG-LSILSGDTGSGKSILLDALILVT 45 (554) Q Consensus 10 ~~i~~~~i~f~~G-l~vItGetGaGKS~ildAl~~~l 45 (554) ..++++++++.+| +++|+|+||||||+++..|+-++ T Consensus 16 ~aL~~vsl~i~~Ge~vaiiG~nGsGKSTL~~~l~Gll 52 (274) T PRK13644 16 PALENINLVIKKGEYIGIIGKNGSGKSTLALHLNGLL 52 (274) T ss_pred EEEEEEEEEECCCCEEEEECCCCCHHHHHHHHHHCCC T ss_conf 4663117798489999999999980999999997068 No 304 >COG2274 SunT ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms] Probab=97.79 E-value=0.00016 Score=48.74 Aligned_cols=73 Identities=23% Similarity=0.308 Sum_probs=64.6 Q ss_pred HCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCEEEEECHHHHHHHCCCEEEEEE Q ss_conf 06215799999999984366899769980344688879999999999997305939998083798650176179999 Q gi|255764514|r 428 ASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSKKIQLLAVTHAPQVAARADRHFLVYK 504 (554) Q Consensus 428 aSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~~~Qvi~ITH~pqvAa~a~~h~~v~K 504 (554) +|||-+=|++||-.++ .++|.+||||-=++++-.+-..|-+.|.++....=+|+|||-|-+...+|+=++..+ T Consensus 610 LSGGQrQrlalARaLl----~~P~ILlLDEaTSaLD~~sE~~I~~~L~~~~~~~T~I~IaHRl~ti~~adrIiVl~~ 682 (709) T COG2274 610 LSGGQRQRLALARALL----SKPKILLLDEATSALDPETEAIILQNLLQILQGRTVIIIAHRLSTIRSADRIIVLDQ 682 (709) T ss_pred CCHHHHHHHHHHHHHC----CCCCEEEEECCCCCCCHHHHHHHHHHHHHHHCCCEEEEEECCCHHHHHCCEEEECCC T ss_conf 8888999999999854----699989970742236986799999999998458869999766168640257998169 No 305 >PRK13645 cbiO cobalt transporter ATP-binding subunit; Provisional Probab=97.79 E-value=3.4e-05 Score=53.20 Aligned_cols=35 Identities=23% Similarity=0.401 Sum_probs=29.4 Q ss_pred EEEEEEEECCCC-EEEEECCCCCCHHHHHHHHHHHH Q ss_conf 899998873898-18998899978889999999871 Q gi|255764514|r 11 LIESLDIDFSAG-LSILSGDTGSGKSILLDALILVT 45 (554) Q Consensus 11 ~i~~~~i~f~~G-l~vItGetGaGKS~ildAl~~~l 45 (554) .++++++++.+| +++|+|+||||||+++..|.-++ T Consensus 26 AL~~vsl~i~~Ge~~aIiG~nGsGKSTL~~~l~Gll 61 (289) T PRK13645 26 ALNNTSLTFKKNKVTCVIGTTGSGKSTMIQLTNGLI 61 (289) T ss_pred EEECCEEEECCCCEEEEECCCCCHHHHHHHHHHCCC T ss_conf 865328898899899999999957999999996598 No 306 >PRK13650 cbiO cobalt transporter ATP-binding subunit; Provisional Probab=97.79 E-value=4.2e-05 Score=52.56 Aligned_cols=35 Identities=20% Similarity=0.318 Sum_probs=29.9 Q ss_pred EEEEEEEECCCC-EEEEECCCCCCHHHHHHHHHHHH Q ss_conf 899998873898-18998899978889999999871 Q gi|255764514|r 11 LIESLDIDFSAG-LSILSGDTGSGKSILLDALILVT 45 (554) Q Consensus 11 ~i~~~~i~f~~G-l~vItGetGaGKS~ildAl~~~l 45 (554) .++++++++.+| +.+|+|+||||||+++..|.-++ T Consensus 19 aL~~vsl~i~~GE~vaivG~nGsGKSTL~~~l~Gll 54 (276) T PRK13650 19 TLDDVSFHVKQGEWLSIIGHNGSGKSTTVRLIDGLL 54 (276) T ss_pred EEECCEEEECCCCEEEEECCCCCHHHHHHHHHHCCC T ss_conf 878758799899899999999987999999997388 No 307 >PRK11264 putative amino-acid ABC transporter ATP-binding protein YecC; Provisional Probab=97.79 E-value=0.00019 Score=48.28 Aligned_cols=37 Identities=27% Similarity=0.594 Sum_probs=31.6 Q ss_pred CCEEEEEEEEECCCC-EEEEECCCCCCHHHHHHHHHHH Q ss_conf 227899998873898-1899889997888999999987 Q gi|255764514|r 8 NIVLIESLDIDFSAG-LSILSGDTGSGKSILLDALILV 44 (554) Q Consensus 8 Nf~~i~~~~i~f~~G-l~vItGetGaGKS~ildAl~~~ 44 (554) +...++++++++.+| +++|+||||||||+++.+|+.+ T Consensus 13 ~~~vl~~vsl~i~~Ge~~aliG~sGsGKSTLl~~l~gl 50 (248) T PRK11264 13 GQTVLHGIDLEVKPGEVVAIIGPSGSGKTTLLRCINLL 50 (248) T ss_pred CEEEEECEEEEECCCCEEEEECCCCCCHHHHHHHHHCC T ss_conf 99989431779879989999999998099999999758 No 308 >cd03269 ABC_putative_ATPase This subfamily is involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity. In eubacteria and archaea, the typical organization consists of one ABC and one or two IMs. Eukaryote systems of the ABCA subfamily display ABC domains strongly similar to this family. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region in addition to the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins. Probab=97.78 E-value=4.4e-05 Score=52.42 Aligned_cols=73 Identities=18% Similarity=0.283 Sum_probs=59.1 Q ss_pred HHCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHC-CCEEEEECHHHHHHH-CCCEEEEE Q ss_conf 406215799999999984366899769980344688879999999999997305-939998083798650-17617999 Q gi|255764514|r 427 LASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSKK-IQLLAVTHAPQVAAR-ADRHFLVY 503 (554) Q Consensus 427 iaSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~~-~Qvi~ITH~pqvAa~-a~~h~~v~ 503 (554) -+|||.+-|+++|..++ ..++.+++||.=+|++-.+...+-+.|+++.+. .-||.+||...-+.. +|+=+.+. T Consensus 128 ~LSgG~kqrv~la~al~----~~p~lllLDEPt~gLDp~~~~~i~~~i~~~~~~g~til~ssH~l~e~~~~~d~i~vl~ 202 (210) T cd03269 128 ELSKGNQQKVQFIAAVI----HDPELLILDEPFSGLDPVNVELLKDVIRELARAGKTVILSTHQMELVEELCDRVLLLN 202 (210) T ss_pred HCCHHHHHHHHHHHHHH----CCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCEEEEECCCHHHHHHHCCEEEEEE T ss_conf 78998999999999995----7998999928866799999999999999999689899998884899999699999998 No 309 >TIGR03411 urea_trans_UrtD urea ABC transporter, ATP-binding protein UrtD. Members of this protein family are ABC transporter ATP-binding subunits associated with urea transport and metabolism. This protein is found in a conserved five-gene transport operon typically found adjacent to urease genes. It was shown in Cyanobacteria that disruption leads to the loss of high-affinity urea transport activity. Probab=97.78 E-value=5.1e-05 Score=52.02 Aligned_cols=36 Identities=22% Similarity=0.516 Sum_probs=30.6 Q ss_pred CCEEEEEEEEECCCC-EEEEECCCCCCHHHHHHHHHH Q ss_conf 227899998873898-189988999788899999998 Q gi|255764514|r 8 NIVLIESLDIDFSAG-LSILSGDTGSGKSILLDALIL 43 (554) Q Consensus 8 Nf~~i~~~~i~f~~G-l~vItGetGaGKS~ildAl~~ 43 (554) ++..+++++++..+| +.+|.||||||||+++.+|+= T Consensus 14 ~~~al~~vsl~v~~Gei~~liGpNGaGKSTLl~~i~G 50 (242) T TIGR03411 14 GFKALNDLSLYVDPGELRVIIGPNGAGKTTMMDVITG 50 (242) T ss_pred CEEEECCCEEEECCCCEEEEECCCCCCHHHHHHHHHC T ss_conf 9898745078988998999998999759999999967 No 310 >PRK13649 cbiO cobalt transporter ATP-binding subunit; Provisional Probab=97.78 E-value=3.2e-05 Score=53.34 Aligned_cols=35 Identities=29% Similarity=0.469 Sum_probs=29.4 Q ss_pred EEEEEEEECCCC-EEEEECCCCCCHHHHHHHHHHHH Q ss_conf 899998873898-18998899978889999999871 Q gi|255764514|r 11 LIESLDIDFSAG-LSILSGDTGSGKSILLDALILVT 45 (554) Q Consensus 11 ~i~~~~i~f~~G-l~vItGetGaGKS~ildAl~~~l 45 (554) .++++++++.+| +++|+|+||||||+++..|+-++ T Consensus 22 aL~~Vsl~i~~Ge~~aiiG~nGsGKSTLl~~l~Gl~ 57 (280) T PRK13649 22 ALFDVNLDILDGSYTAFIGHTGSGKSTIMQLLNGLH 57 (280) T ss_pred EEEEEEEEECCCCEEEEECCCCCHHHHHHHHHHCCC T ss_conf 541026898799899999599986999999996699 No 311 >PRK13651 cobalt transporter ATP-binding subunit; Provisional Probab=97.78 E-value=3.5e-05 Score=53.12 Aligned_cols=36 Identities=22% Similarity=0.490 Sum_probs=30.6 Q ss_pred EEEEEEEEECCCC-EEEEECCCCCCHHHHHHHHHHHH Q ss_conf 7899998873898-18998899978889999999871 Q gi|255764514|r 10 VLIESLDIDFSAG-LSILSGDTGSGKSILLDALILVT 45 (554) Q Consensus 10 ~~i~~~~i~f~~G-l~vItGetGaGKS~ildAl~~~l 45 (554) ..+++++++..+| +.+|+|+||||||+++..|+-++ T Consensus 21 ~AL~dvsl~I~~GE~v~IiG~nGsGKSTL~k~l~Gll 57 (304) T PRK13651 21 KALDGVSTEINQGEFIAIIGQTGSGKTTFIEHLNALL 57 (304) T ss_pred EEEECEEEEECCCCEEEEECCCCCCHHHHHHHHHCCC T ss_conf 6863405798599899998799985999999996699 No 312 >cd03254 ABCC_Glucan_exporter_like Glucan exporter ATP-binding protein. In A. tumefaciens cyclic beta-1, 2-glucan must be transported into the periplasmic space to exert its action as a virluence factor. This subfamily belongs to the MRP-like family and is involved in drug, peptide, and lipid export. The MRP-like family, similar to all ABC proteins, have a common four-domain core structure constituted by two membrane-spanning domains each composed of six transmembrane (TM) helices and two nucleotide-binding domains (NBD). ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins. Probab=97.78 E-value=3.7e-05 Score=52.94 Aligned_cols=33 Identities=24% Similarity=0.590 Sum_probs=28.5 Q ss_pred EEEEEEEECCCC-EEEEECCCCCCHHHHHHHHHH Q ss_conf 899998873898-189988999788899999998 Q gi|255764514|r 11 LIESLDIDFSAG-LSILSGDTGSGKSILLDALIL 43 (554) Q Consensus 11 ~i~~~~i~f~~G-l~vItGetGaGKS~ildAl~~ 43 (554) .++++++.+.+| +.+|+|+||||||+++..|.- T Consensus 18 vL~~inl~i~~Ge~vaivG~sGsGKSTLl~ll~g 51 (229) T cd03254 18 VLKDINFSIKPGETVAIVGPTGAGKTTLINLLMR 51 (229) T ss_pred EEECEEEEECCCCEEEEECCCCCHHHHHHHHHHC T ss_conf 8746299987999999999999809999999966 No 313 >PRK11288 araG L-arabinose transporter ATP-binding protein; Provisional Probab=97.78 E-value=0.00047 Score=45.68 Aligned_cols=35 Identities=34% Similarity=0.636 Sum_probs=29.6 Q ss_pred CCEEEEEEEEECCCC-EEEEECCCCCCHHHHHHHHH Q ss_conf 227899998873898-18998899978889999999 Q gi|255764514|r 8 NIVLIESLDIDFSAG-LSILSGDTGSGKSILLDALI 42 (554) Q Consensus 8 Nf~~i~~~~i~f~~G-l~vItGetGaGKS~ildAl~ 42 (554) +....+++++++.+| +.+|+||||||||+++..|+ T Consensus 16 ~~~aL~~vsl~i~~Ge~~~lvG~nGaGKSTL~~~l~ 51 (501) T PRK11288 16 GVKALDDISFDVRAGQVHALMGENGAGKSTLLKILS 51 (501) T ss_pred CEEEECCEEEEECCCCEEEEECCCCCCHHHHHHHHH T ss_conf 999877658998898199998999981999999984 No 314 >PRK10584 putative ABC transporter ATP-binding protein YbbA; Provisional Probab=97.78 E-value=3.8e-05 Score=52.87 Aligned_cols=36 Identities=31% Similarity=0.485 Sum_probs=29.6 Q ss_pred EEEEEEEEECCCC-EEEEECCCCCCHHHHHHHHHHHH Q ss_conf 7899998873898-18998899978889999999871 Q gi|255764514|r 10 VLIESLDIDFSAG-LSILSGDTGSGKSILLDALILVT 45 (554) Q Consensus 10 ~~i~~~~i~f~~G-l~vItGetGaGKS~ildAl~~~l 45 (554) ..++++++++.+| +.+|+||||||||+++..|.-++ T Consensus 24 ~vL~~isl~i~~GE~v~ivG~sGsGKSTLl~~i~Gl~ 60 (228) T PRK10584 24 SILTGVELVVKRGETIALIGESGSGKSTLLAILAGLD 60 (228) T ss_pred EEEECEEEEECCCCEEEEECCCCCHHHHHHHHHHCCC T ss_conf 9984738899999899999999858999999996699 No 315 >PRK10419 nikE nickel transporter ATP-binding protein; Provisional Probab=97.78 E-value=0.00027 Score=47.29 Aligned_cols=74 Identities=26% Similarity=0.332 Sum_probs=59.5 Q ss_pred HCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHH--CCCEEEEECHHHHHHHCCCEEEEEEE Q ss_conf 0621579999999998436689976998034468887999999999999730--59399980837986501761799996 Q gi|255764514|r 428 ASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSK--KIQLLAVTHAPQVAARADRHFLVYKT 505 (554) Q Consensus 428 aSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~--~~Qvi~ITH~pqvAa~a~~h~~v~K~ 505 (554) +|||++=|+++|..++. ...++|+||.=++++-.+...|-+.|+++.+ ..=+|.|||--.+|+.--....|-+. T Consensus 152 LSGGq~QRVaIArAL~~----~P~lLi~DEPtsaLD~~~q~~il~ll~~l~~~~g~t~i~ITHDl~~a~~~adri~Vm~~ 227 (266) T PRK10419 152 LSGGQLQRVCLARALAV----EPKLLILDEAVSNLDLVLQAGVIRLLKKLQQQFGTACLFITHDLRLVERFCQRVMVMDN 227 (266) T ss_pred CCHHHHHHHHHHHHHCC----CCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHHCCEEEEECCCHHHHHHHCCEEEEEEC T ss_conf 79278777898666406----98789996886536999999999999999997598999988999999996898999989 No 316 >PRK13642 cbiO cobalt transporter ATP-binding subunit; Provisional Probab=97.78 E-value=4.8e-05 Score=52.20 Aligned_cols=34 Identities=21% Similarity=0.320 Sum_probs=28.5 Q ss_pred EEEEEEECCCC-EEEEECCCCCCHHHHHHHHHHHH Q ss_conf 99998873898-18998899978889999999871 Q gi|255764514|r 12 IESLDIDFSAG-LSILSGDTGSGKSILLDALILVT 45 (554) Q Consensus 12 i~~~~i~f~~G-l~vItGetGaGKS~ildAl~~~l 45 (554) ++++++++.+| +.+|+||||||||+++..|.-++ T Consensus 23 L~~is~~i~~Ge~~aiiG~sGsGKSTL~~~l~Gl~ 57 (277) T PRK13642 23 LNGVSFSITKGEWVSIIGQNGSGKSTTARLIDGLF 57 (277) T ss_pred EECEEEEECCCCEEEEECCCCCHHHHHHHHHHCCC T ss_conf 44307998899899999999968999999996389 No 317 >PRK13652 cbiO cobalt transporter ATP-binding subunit; Provisional Probab=97.77 E-value=3.7e-05 Score=52.97 Aligned_cols=36 Identities=17% Similarity=0.216 Sum_probs=29.4 Q ss_pred EEEEEEEEECCCC-EEEEECCCCCCHHHHHHHHHHHH Q ss_conf 7899998873898-18998899978889999999871 Q gi|255764514|r 10 VLIESLDIDFSAG-LSILSGDTGSGKSILLDALILVT 45 (554) Q Consensus 10 ~~i~~~~i~f~~G-l~vItGetGaGKS~ildAl~~~l 45 (554) ..++++++++.+| +.+|+||||||||+++..|+-++ T Consensus 18 ~aL~~is~~i~~Ge~~aliG~NGaGKSTLl~~i~Gll 54 (277) T PRK13652 18 EALNNINFIAGRKQRIAVIGPNGAGKSTLFKHFNGIL 54 (277) T ss_pred EEEECCEEEECCCCEEEEECCCCCHHHHHHHHHHCCC T ss_conf 7986728799899899999999947999999996699 No 318 >cd03293 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins. Probab=97.77 E-value=4.1e-05 Score=52.65 Aligned_cols=37 Identities=27% Similarity=0.516 Sum_probs=31.3 Q ss_pred CEEEEEEEEECCCC-EEEEECCCCCCHHHHHHHHHHHH Q ss_conf 27899998873898-18998899978889999999871 Q gi|255764514|r 9 IVLIESLDIDFSAG-LSILSGDTGSGKSILLDALILVT 45 (554) Q Consensus 9 f~~i~~~~i~f~~G-l~vItGetGaGKS~ildAl~~~l 45 (554) +..++++++++.+| +.+|+||||||||+++..|.-++ T Consensus 17 ~~al~~vsl~i~~Ge~~~iiGpsGsGKSTLl~~i~Gl~ 54 (220) T cd03293 17 VTALEDISLSVEEGEFVALVGPSGCGKSTLLRIIAGLE 54 (220) T ss_pred EEEEECEEEEECCCCEEEEECCCCCHHHHHHHHHHCCC T ss_conf 99996718898799899999999957999999997599 No 319 >KOG0061 consensus Probab=97.77 E-value=8.4e-05 Score=50.60 Aligned_cols=36 Identities=31% Similarity=0.431 Sum_probs=30.7 Q ss_pred CEEEEEEEEECCCC-EEEEECCCCCCHHHHHHHHHHH Q ss_conf 27899998873898-1899889997888999999987 Q gi|255764514|r 9 IVLIESLDIDFSAG-LSILSGDTGSGKSILLDALILV 44 (554) Q Consensus 9 f~~i~~~~i~f~~G-l~vItGetGaGKS~ildAl~~~ 44 (554) -.+++.++-.+.|| +++|-||.|||||++|+||.-- T Consensus 43 k~iL~~vsg~~~~Gel~AimG~SGsGKtTLL~~Lagr 79 (613) T KOG0061 43 KTILKGVSGTAKPGELLAIMGPSGSGKTTLLNALAGR 79 (613) T ss_pred CEEECCCEEEEECCEEEEEECCCCCCHHHHHHHHHCC T ss_conf 0432187799867868999768887799999999577 No 320 >PRK13632 cbiO cobalt transporter ATP-binding subunit; Provisional Probab=97.77 E-value=3.9e-05 Score=52.79 Aligned_cols=35 Identities=23% Similarity=0.401 Sum_probs=30.3 Q ss_pred EEEEEEEECCCC-EEEEECCCCCCHHHHHHHHHHHH Q ss_conf 899998873898-18998899978889999999871 Q gi|255764514|r 11 LIESLDIDFSAG-LSILSGDTGSGKSILLDALILVT 45 (554) Q Consensus 11 ~i~~~~i~f~~G-l~vItGetGaGKS~ildAl~~~l 45 (554) .++++++++.+| +++|+|+||||||+++..|.-++ T Consensus 25 ~L~~isl~i~~Ge~vaivG~nGsGKSTLlk~l~Gll 60 (273) T PRK13632 25 ALKNVSFTINEGEYVAILGHNGSGKSTISKILTGLL 60 (273) T ss_pred EEEEEEEEECCCCEEEEECCCCCHHHHHHHHHHCCC T ss_conf 066428898499899999999986999999997387 No 321 >PRK13546 teichoic acids export protein ATP-binding subunit; Provisional Probab=97.77 E-value=3.3e-05 Score=53.25 Aligned_cols=39 Identities=23% Similarity=0.260 Sum_probs=32.6 Q ss_pred ECCEEEEEEEEECCCC-EEEEECCCCCCHHHHHHHHHHHH Q ss_conf 4227899998873898-18998899978889999999871 Q gi|255764514|r 7 YNIVLIESLDIDFSAG-LSILSGDTGSGKSILLDALILVT 45 (554) Q Consensus 7 ~Nf~~i~~~~i~f~~G-l~vItGetGaGKS~ildAl~~~l 45 (554) ++|.-.++++++..+| +.+|.||||||||+++..|.-++ T Consensus 35 ~~f~AL~dVsf~i~~GEivgllG~NGaGKSTLlk~I~Gl~ 74 (264) T PRK13546 35 KTFFALDDISLKAYEGDVIGLVGINGSGKSTLSNIIGGSL 74 (264) T ss_pred CEEEEECCCEEEECCCCEEEEECCCCCHHHHHHHHHHCCC T ss_conf 8899952707888599899999899861999999996798 No 322 >PRK09473 oppD oligopeptide transporter ATP-binding component; Provisional Probab=97.77 E-value=5.1e-05 Score=52.02 Aligned_cols=72 Identities=26% Similarity=0.371 Sum_probs=55.0 Q ss_pred HCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHC--CCEEEEECHHHHHHH-CCCEEEEEE Q ss_conf 06215799999999984366899769980344688879999999999997305--939998083798650-176179999 Q gi|255764514|r 428 ASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSKK--IQLLAVTHAPQVAAR-ADRHFLVYK 504 (554) Q Consensus 428 aSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~~--~Qvi~ITH~pqvAa~-a~~h~~v~K 504 (554) +|||++=|+++|..++. ....+|+||.-+|++-.+-..|-++|++|.+. .=+|.|||--.+++. +|+ ..|-. T Consensus 162 LSGGq~QRV~IArAL~~----~P~lLI~DEPTsaLDv~~q~~Il~ll~~l~~e~g~til~ITHDl~~v~~~~Dr-I~VMy 236 (330) T PRK09473 162 FSGGMRQRVMIAMALLC----RPKLLIADEPTTALDVTVQAQIMTLLNELKREFNTAIIMITHDLGVVAGICDK-VLVMY 236 (330) T ss_pred CCHHHHHHHHHHHHHHC----CCCEEEECCCCCCCCHHHHHHHHHHHHHHHHHCCCCEEEECCCHHHHHHHCCE-EEEEE T ss_conf 39889999999999970----99999973875547999999999999999997499479982889999986998-99998 No 323 >cd03251 ABCC_MsbA MsbA is an essential ABC transporter, closely related to eukaryotic MDR proteins. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins. Probab=97.77 E-value=3.4e-05 Score=53.20 Aligned_cols=33 Identities=33% Similarity=0.601 Sum_probs=28.7 Q ss_pred EEEEEEEEECCCC-EEEEECCCCCCHHHHHHHHH Q ss_conf 7899998873898-18998899978889999999 Q gi|255764514|r 10 VLIESLDIDFSAG-LSILSGDTGSGKSILLDALI 42 (554) Q Consensus 10 ~~i~~~~i~f~~G-l~vItGetGaGKS~ildAl~ 42 (554) ..++++++++.+| +.+|+|+||||||+|+..|. T Consensus 16 ~vL~ninl~i~~Ge~i~IvG~sGsGKSTLl~ll~ 49 (234) T cd03251 16 PVLRDISLDIPAGETVALVGPSGSGKSTLVNLIP 49 (234) T ss_pred CCEECEEEEECCCCEEEEECCCCCHHHHHHHHHH T ss_conf 7353608998799999999899982999999996 No 324 >cd03268 ABC_BcrA_bacitracin_resist The BcrA subfamily represents ABC transporters involved in peptide antibiotic resistance. Bacitracin is a dodecapeptide antibiotic produced by B. licheniformis and B. subtilis. The synthesis of bacitracin is non-ribosomally catalyzed by a multienzyme complex BcrABC. Bacitracin has potent antibiotic activity against gram-positive bacteria. The inhibition of peptidoglycan biosynthesis is the best characterized bacterial effect of bacitracin. The bacitracin resistance of B. licheniformis is mediated by the ABC transporter Bcr which is composed of two identical BcrA ATP-binding subunits and one each of the integral membrane proteins, BcrB and BcrC. B. subtilis cells carrying bcr genes on high-copy number plasmids develop collateral detergent sensitivity, a similar phenomenon in human cells with overexpressed multi-drug resistance P-glycoprotein. Probab=97.76 E-value=5.1e-05 Score=52.01 Aligned_cols=39 Identities=13% Similarity=0.327 Sum_probs=32.5 Q ss_pred ECCEEEEEEEEECCCC-EEEEECCCCCCHHHHHHHHHHHH Q ss_conf 4227899998873898-18998899978889999999871 Q gi|255764514|r 7 YNIVLIESLDIDFSAG-LSILSGDTGSGKSILLDALILVT 45 (554) Q Consensus 7 ~Nf~~i~~~~i~f~~G-l~vItGetGaGKS~ildAl~~~l 45 (554) .+...++++++++.+| +..+.||||||||+++..|.=++ T Consensus 11 g~~~al~~vs~~v~~Gei~gllG~NGaGKSTLl~~i~Gl~ 50 (208) T cd03268 11 GKKRVLDDISLHVKKGEIYGFLGPNGAGKTTTMKIILGLI 50 (208) T ss_pred CCEEEECCEEEEECCCCEEEEECCCCCCHHHHHHHHHCCC T ss_conf 9999871516688698199999999999999999995783 No 325 >PRK13634 cbiO cobalt transporter ATP-binding subunit; Provisional Probab=97.76 E-value=2.5e-05 Score=54.11 Aligned_cols=36 Identities=31% Similarity=0.449 Sum_probs=30.6 Q ss_pred EEEEEEEEECCCC-EEEEECCCCCCHHHHHHHHHHHH Q ss_conf 7899998873898-18998899978889999999871 Q gi|255764514|r 10 VLIESLDIDFSAG-LSILSGDTGSGKSILLDALILVT 45 (554) Q Consensus 10 ~~i~~~~i~f~~G-l~vItGetGaGKS~ildAl~~~l 45 (554) ..++++++++.+| +.+|+|+||||||+++..|+-++ T Consensus 8 ~AL~~Vsl~i~~Ge~vaiiG~sGsGKSTLl~~l~GLl 44 (276) T PRK13634 8 RALYDVNVSIPSGSYVAIIGHTGSGKSTLLQHLNGLL 44 (276) T ss_pred EEEECCEEEECCCCEEEEECCCCCHHHHHHHHHHCCC T ss_conf 6651447799899899999999969999999997499 No 326 >PRK13639 cbiO cobalt transporter ATP-binding subunit; Provisional Probab=97.76 E-value=3.9e-05 Score=52.84 Aligned_cols=37 Identities=22% Similarity=0.372 Sum_probs=30.8 Q ss_pred CEEEEEEEEECCCC-EEEEECCCCCCHHHHHHHHHHHH Q ss_conf 27899998873898-18998899978889999999871 Q gi|255764514|r 9 IVLIESLDIDFSAG-LSILSGDTGSGKSILLDALILVT 45 (554) Q Consensus 9 f~~i~~~~i~f~~G-l~vItGetGaGKS~ildAl~~~l 45 (554) ...+++++++..+| +++|.|+||||||+++..|+-++ T Consensus 15 ~~al~~vsl~I~~Ge~vaiiG~nGsGKSTLl~~l~Gll 52 (275) T PRK13639 15 TVALKGINFKAEEGEMIAILGPNGAGKSTLFLHFNGIL 52 (275) T ss_pred CEEEECCEEEECCCCEEEEECCCCCHHHHHHHHHHCCC T ss_conf 89998648899899899999999964999999997398 No 327 >TIGR02673 FtsE cell division ATP-binding protein FtsE; InterPro: IPR005286 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems. ABC transporters are minimally constituted of two conserved regions: a highly conserved ATP binding cassette (ABC) and a less conserved transmembrane domain (TMD). These regions can be found on the same protein or on two different ones. Most ABC transporters function as a dimer and therefore are constituted of four domains, two ABC modules and two TMDs. ABC transporters are involved in the export or import of a wide variety of substrates ranging from small ions to macromolecules. The major function of ABC import systems is to provide essential nutrients to bacteria. They are found only in prokaryotes and their four constitutive domains are usually encoded by independent polypeptides (two ABC proteins and two TMD proteins). Prokaryotic importers require additional extracytoplasmic binding proteins (one or more per systems) for function. In contrast, export systems are involved in the extrusion of noxious substances, the export of extracellular toxins and the targeting of membrane components. They are found in all living organisms and in general the TMD is fused to the ABC module in a variety of combinations. Some eukaryotic exporters encode the four domains on the same polypeptide chain . The ABC module (approximately two hundred amino acid residues) is known to bind and hydrolyze ATP, thereby coupling transport to ATP hydrolysis in a large number of biological processes. The cassette is duplicated in several subfamilies. Its primary sequence is highly conserved, displaying a typical phosphate-binding loop: Walker A, and a magnesium binding site: Walker B. Besides these two regions, three other conserved motifs are present in the ABC cassette: the switch region which contains a histidine loop, postulated to polarize the attaching water molecule for hydrolysis, the signature conserved motif (LSGGQ) specific to the ABC transporter, and the Q-motif (between Walker A and the signature), which interacts with the gamma phosphate through a water bond. The Walker A, Walker B, Q-loop and switch region form the nucleotide binding site , , . The 3D structure of a monomeric ABC module adopts a stubby L-shape with two distinct arms. ArmI (mainly beta-strand) contains Walker A and Walker B. The important residues for ATP hydrolysis and/or binding are located in the P-loop. The ATP-binding pocket is located at the extremity of armI. The perpendicular armII contains mostly the alpha helical subdomain with the signature motif. It only seems to be required for structural integrity of the ABC module. ArmII is in direct contact with the TMD. The hinge between armI and armII contains both the histidine loop and the Q-loop, making contact with the gamma phosphate of the ATP molecule. ATP hydrolysis leads to a conformational change that could facilitate ADP release. In the dimer the two ABC cassettes contact each other through hydrophobic interactions at the antiparallel beta-sheet of armI by a two-fold axis , , , , , . Proteins known to belong to this family are classified in several functional subfamilies depending on the substrate used (for further information see http://www.tcdb.org/tcdb/index.php?tc=3.A.1). FtsE is an ABC transporter ATP-binding protein. This protein and its permease partner FtsX, localize to the cell division site. In a number of species, the ftsEX gene pair is located next to ftsY, which encodes the signal recognition particle-docki ng protein.; GO: 0005524 ATP binding, 0051301 cell division. Probab=97.76 E-value=2e-05 Score=54.77 Aligned_cols=40 Identities=23% Similarity=0.407 Sum_probs=32.1 Q ss_pred ECCEEEEEEEEECCCC-EEEEECCCCCCHHHHHHHHHHHHC Q ss_conf 4227899998873898-189988999788899999998714 Q gi|255764514|r 7 YNIVLIESLDIDFSAG-LSILSGDTGSGKSILLDALILVTG 46 (554) Q Consensus 7 ~Nf~~i~~~~i~f~~G-l~vItGetGaGKS~ildAl~~~lG 46 (554) .++...+++++.+.|| |-.+||++|||||+||-=||-++= T Consensus 13 ~~~~aL~~v~l~i~kG~F~FLtG~SGAGKttLLKLl~~~~~ 53 (215) T TIGR02673 13 GGVEALHDVSLHIRKGEFLFLTGPSGAGKTTLLKLLYGALT 53 (215) T ss_pred CCCHHHCCCCEEECCCCEEEEECCCCCCHHHHHHHHHHHCC T ss_conf 98511327644752774078872778617899999985269 No 328 >cd03259 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Transporters-like subgroup. This family is comprised of proteins involved in the transport of apparently unrelated solutes and proteins specific for di- and oligosaccharides and polyols. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides and more complex organic molecules. The nucleotide-binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins. Probab=97.76 E-value=5.7e-05 Score=51.70 Aligned_cols=39 Identities=23% Similarity=0.419 Sum_probs=31.9 Q ss_pred ECCEEEEEEEEECCCC-EEEEECCCCCCHHHHHHHHHHHH Q ss_conf 4227899998873898-18998899978889999999871 Q gi|255764514|r 7 YNIVLIESLDIDFSAG-LSILSGDTGSGKSILLDALILVT 45 (554) Q Consensus 7 ~Nf~~i~~~~i~f~~G-l~vItGetGaGKS~ildAl~~~l 45 (554) .++..++++++++.+| +.+|.||||||||+++.+|+-+. T Consensus 11 g~~~al~~vs~~i~~Gei~~iiGpnGaGKSTl~~~i~Gl~ 50 (213) T cd03259 11 GSVRALDDLSLTVEPGEFLALLGPSGCGKTTLLRLIAGLE 50 (213) T ss_pred CCEEEECCCEEEECCCCEEEEECCCCCHHHHHHHHHHCCC T ss_conf 9999984617798899899999999973999999997599 No 329 >PRK13635 cbiO cobalt transporter ATP-binding subunit; Provisional Probab=97.75 E-value=4.5e-05 Score=52.42 Aligned_cols=35 Identities=26% Similarity=0.366 Sum_probs=29.6 Q ss_pred EEEEEEEECCCC-EEEEECCCCCCHHHHHHHHHHHH Q ss_conf 899998873898-18998899978889999999871 Q gi|255764514|r 11 LIESLDIDFSAG-LSILSGDTGSGKSILLDALILVT 45 (554) Q Consensus 11 ~i~~~~i~f~~G-l~vItGetGaGKS~ildAl~~~l 45 (554) .++++++++.+| +.+|+||||||||+++.+|+-++ T Consensus 22 aL~~isl~i~~GE~vaivG~nGsGKSTL~k~l~Gl~ 57 (279) T PRK13635 22 ALKDVSFSVYEGEWVAIVGHNGSGKSTLAKLLNGLL 57 (279) T ss_pred EEEEEEEEECCCCEEEEECCCCCHHHHHHHHHHCCC T ss_conf 576307688799899999999965999999997288 No 330 >cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE). They are clustered together phylogenetically. MacAB is an exporter that confers resistance to macrolides, while the LolCDE system is not a transporter at all. An FtsE null mutants showed filamentous growth and appeared viable on high salt medium only, indicating a role for FtsE in cell division and/or salt transport. The LolCDE complex catalyses the release of lipoproteins from the cytoplasmic membrane prior to their targeting to the outer membrane. Probab=97.75 E-value=4.1e-05 Score=52.62 Aligned_cols=37 Identities=27% Similarity=0.485 Sum_probs=31.4 Q ss_pred CEEEEEEEEECCCC-EEEEECCCCCCHHHHHHHHHHHH Q ss_conf 27899998873898-18998899978889999999871 Q gi|255764514|r 9 IVLIESLDIDFSAG-LSILSGDTGSGKSILLDALILVT 45 (554) Q Consensus 9 f~~i~~~~i~f~~G-l~vItGetGaGKS~ildAl~~~l 45 (554) ...++++++++.+| +.+|+||||||||+++.+|.-++ T Consensus 17 ~~al~~isl~i~~Ge~~~iiG~sGsGKTTll~~i~Gl~ 54 (218) T cd03255 17 VQALKGVSLSIEKGEFVAIVGPSGSGKSTLLNILGGLD 54 (218) T ss_pred EEEEECEEEEECCCCEEEEECCCCCHHHHHHHHHHCCC T ss_conf 99985628998699899999999986999999996699 No 331 >cd03245 ABCC_bacteriocin_exporters ABC-type bacteriocin exporters. Many non-lantibiotic bacteriocins of lactic acid bacteria are produced as precursors which have N-terminal leader peptides that share similarities in amino acid sequence and contain a conserved processing site of two glycine residues in positions -1 and -2. A dedicated ATP-binding cassette (ABC) transporter is responsible for the proteolytic cleavage of the leader peptides and subsequent translocation of the bacteriocins across the cytoplasmic membrane. Probab=97.75 E-value=3.9e-05 Score=52.79 Aligned_cols=35 Identities=31% Similarity=0.475 Sum_probs=29.3 Q ss_pred EEEEEEEEECCCC-EEEEECCCCCCHHHHHHHHHHH Q ss_conf 7899998873898-1899889997888999999987 Q gi|255764514|r 10 VLIESLDIDFSAG-LSILSGDTGSGKSILLDALILV 44 (554) Q Consensus 10 ~~i~~~~i~f~~G-l~vItGetGaGKS~ildAl~~~ 44 (554) ..++++++++.+| +.+|+|+||||||+|+..|.=. T Consensus 18 ~~L~~isl~i~~G~~v~ivG~sGsGKSTLl~ll~gl 53 (220) T cd03245 18 PALDNVSLTIRAGEKVAIIGRVGSGKSTLLKLLAGL 53 (220) T ss_pred CCEECEEEEECCCCEEEEECCCCCHHHHHHHHHHCC T ss_conf 515345999879999999999998599999999672 No 332 >cd03263 ABC_subfamily_A The ABCA subfamily mediates the transport of a variety of lipid compounds. Mutations of members of ABCA subfamily are associated with human genetic diseases, such as, familial high-density lipoprotein (HDL) deficiency, neonatal surfactant deficiency, degenerative retinopathies, and congenital keratinization disorders. The ABCA1 protein is involved in disorders of cholesterol transport and high-density lipoprotein (HDL) biosynthesis. The ABCA4 (ABCR) protein transports vitamin A derivatives in the outer segments of photoreceptor cells, and therefore, performs a crucial step in the visual cycle. The ABCA genes are not present in yeast. However, evolutionary studies of ABCA genes indicate that they arose as transporters that subsequently duplicated and that certain sets of ABCA genes were lost in different eukaryotic lineages. Probab=97.75 E-value=4.8e-05 Score=52.23 Aligned_cols=37 Identities=24% Similarity=0.332 Sum_probs=31.0 Q ss_pred CEEEEEEEEECCCC-EEEEECCCCCCHHHHHHHHHHHH Q ss_conf 27899998873898-18998899978889999999871 Q gi|255764514|r 9 IVLIESLDIDFSAG-LSILSGDTGSGKSILLDALILVT 45 (554) Q Consensus 9 f~~i~~~~i~f~~G-l~vItGetGaGKS~ildAl~~~l 45 (554) ...++++++++.+| +.+|.||||||||+++..|+-++ T Consensus 15 ~~aL~~is~~i~~Gei~~llG~NGaGKSTLl~~i~Gl~ 52 (220) T cd03263 15 KPAVDDLSLNVYKGEIFGLLGHNGAGKTTTLKMLTGEL 52 (220) T ss_pred EEEEECCEEEECCCCEEEEECCCCCCHHHHHHHHHCCC T ss_conf 08984408898499599999899973999999996698 No 333 >cd03244 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C. This family is also known as MRP (mulrtidrug resisitance-associated protein). Some of the MRP members have five additional transmembrane segments in their N-terminus, but the function of these additional membrane-spanning domains is not clear. The MRP was found in the multidrug-resistance lung cancer cell in which p-glycoprotein was not overexpressed. MRP exports glutathione by drug stimulation, as well as, certain substrates in conjugated forms with anions, such as glutathione, glucuronate, and sulfate. Probab=97.75 E-value=4.9e-05 Score=52.17 Aligned_cols=32 Identities=38% Similarity=0.552 Sum_probs=28.5 Q ss_pred EEEEEEEECCCC-EEEEECCCCCCHHHHHHHHH Q ss_conf 899998873898-18998899978889999999 Q gi|255764514|r 11 LIESLDIDFSAG-LSILSGDTGSGKSILLDALI 42 (554) Q Consensus 11 ~i~~~~i~f~~G-l~vItGetGaGKS~ildAl~ 42 (554) .++++++++.+| +.+|+|+||||||+++..|. T Consensus 19 vL~~isl~i~~Ge~v~ivG~sGsGKSTLl~ll~ 51 (221) T cd03244 19 VLKNISFSIKPGEKVGIVGRTGSGKSSLLLALF 51 (221) T ss_pred CEEEEEEEECCCCEEEEECCCCCCHHHHHHHHH T ss_conf 175448998699899999999998999999996 No 334 >PRK13641 cbiO cobalt transporter ATP-binding subunit; Provisional Probab=97.75 E-value=3e-05 Score=53.54 Aligned_cols=34 Identities=29% Similarity=0.583 Sum_probs=28.9 Q ss_pred EEEEEEECCCC-EEEEECCCCCCHHHHHHHHHHHH Q ss_conf 99998873898-18998899978889999999871 Q gi|255764514|r 12 IESLDIDFSAG-LSILSGDTGSGKSILLDALILVT 45 (554) Q Consensus 12 i~~~~i~f~~G-l~vItGetGaGKS~ildAl~~~l 45 (554) ++++++++.+| +++|+|+||||||+++..|+-++ T Consensus 23 L~~vsl~I~~Ge~~~iiG~nGsGKSTLl~~l~Gll 57 (286) T PRK13641 23 LDNISFELEDGSFVALIGHTGSGKSTLMQHFNALL 57 (286) T ss_pred EEEEEEEECCCCEEEEECCCCCHHHHHHHHHHCCC T ss_conf 43106798699999999999839999999996598 No 335 >PRK13640 cbiO cobalt transporter ATP-binding subunit; Provisional Probab=97.75 E-value=3.5e-05 Score=53.08 Aligned_cols=35 Identities=23% Similarity=0.387 Sum_probs=30.3 Q ss_pred EEEEEEEECCCC-EEEEECCCCCCHHHHHHHHHHHH Q ss_conf 899998873898-18998899978889999999871 Q gi|255764514|r 11 LIESLDIDFSAG-LSILSGDTGSGKSILLDALILVT 45 (554) Q Consensus 11 ~i~~~~i~f~~G-l~vItGetGaGKS~ildAl~~~l 45 (554) .++++++++.+| +.+|.|+||||||+++..|+-++ T Consensus 23 aL~~vsl~I~~Ge~vaiiG~nGsGKSTL~~~l~Gll 58 (283) T PRK13640 23 ALKDVSFSIPRGSWTALIGHNGSGKSTISKLINGLL 58 (283) T ss_pred EEECCEEEECCCCEEEEECCCCCHHHHHHHHHHCCC T ss_conf 787718699899999999999987999999996403 No 336 >cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export. They belong to the subfamily C of the ATP-binding cassette (ABC) superfamily of transport proteins. The ABCC subfamily contains transporters with a diverse functional spectrum that includes ion transport, cell surface receptor, and toxin secretion activities. The MRP-like family, simlar to all ABC proteins, have a common four-domain core structure constituted by two membrane-spanning domains, each composed of six transmembrane (TM) helices, and two nucleotide-binding domains (NBD). ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins. Probab=97.74 E-value=4e-05 Score=52.75 Aligned_cols=36 Identities=28% Similarity=0.509 Sum_probs=30.2 Q ss_pred EEEEEEEEECCCC-EEEEECCCCCCHHHHHHHHHHHH Q ss_conf 7899998873898-18998899978889999999871 Q gi|255764514|r 10 VLIESLDIDFSAG-LSILSGDTGSGKSILLDALILVT 45 (554) Q Consensus 10 ~~i~~~~i~f~~G-l~vItGetGaGKS~ildAl~~~l 45 (554) ..++++++++.+| +.+|+|+||||||+++.+|.=.+ T Consensus 16 ~iL~~isl~i~~Ge~i~ivG~sGsGKSTLl~ll~gl~ 52 (171) T cd03228 16 PVLKDVSLTIKPGEKVAIVGPSGSGKSTLLKLLLRLY 52 (171) T ss_pred CCEECEEEEECCCCEEEEECCCCCHHHHHHHHHHCCC T ss_conf 6167718998599899999999983999999997677 No 337 >cd03248 ABCC_TAP TAP, the Transporter Associated with Antigen Processing; TAP is essential for peptide delivery from the cytosol into the lumen of the endoplasmic reticulum (ER), where these peptides are loaded on major histocompatibility complex (MHC) I molecules. Loaded MHC I leave the ER and display their antigenic cargo on the cell surface to cytotoxic T cells. Subsequently, virus-infected or malignantly transformed cells can be eliminated. TAP belongs to the large family of ATP-binding cassette (ABC) transporters, which translocate a vast variety of solutes across membranes. Probab=97.74 E-value=4.8e-05 Score=52.20 Aligned_cols=33 Identities=27% Similarity=0.577 Sum_probs=29.1 Q ss_pred EEEEEEEEECCCC-EEEEECCCCCCHHHHHHHHH Q ss_conf 7899998873898-18998899978889999999 Q gi|255764514|r 10 VLIESLDIDFSAG-LSILSGDTGSGKSILLDALI 42 (554) Q Consensus 10 ~~i~~~~i~f~~G-l~vItGetGaGKS~ildAl~ 42 (554) ..++++++.+.+| +++|+|+||||||+++..|. T Consensus 28 ~vL~~is~~i~~Ge~vaIvG~sGsGKSTL~~ll~ 61 (226) T cd03248 28 LVLQDVSFTLHPGEVTALVGPSGSGKSTVVALLE 61 (226) T ss_pred EEEECEEEEECCCCEEEEECCCCCHHHHHHHHHH T ss_conf 4374538998299999999999984999999996 No 338 >cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis. The CydC and CydD proteins are important for the formation of cytochrome bd terminal oxidase of E. coli and it has been proposed that they were necessary for biosynthesis of the cytochrome bd quinol oxidase and for periplasmic c-type cytochromes. CydCD were proposed to determine a heterooligomeric complex important for heme export into the periplasm or to be involved in the maintenance of the proper redox state of the periplasmic space. In Bacillus subtilius, the absence of CydCD does not affect the presence of halo-cytochrome c in the membrane and this observation suggests that CydCD proteins are not involved in the export of heme in this organism. Probab=97.74 E-value=3.9e-05 Score=52.77 Aligned_cols=36 Identities=33% Similarity=0.477 Sum_probs=30.8 Q ss_pred EEEEEEEEECCCC-EEEEECCCCCCHHHHHHHHHHHH Q ss_conf 7899998873898-18998899978889999999871 Q gi|255764514|r 10 VLIESLDIDFSAG-LSILSGDTGSGKSILLDALILVT 45 (554) Q Consensus 10 ~~i~~~~i~f~~G-l~vItGetGaGKS~ildAl~~~l 45 (554) ..++++++++.+| +.+|+|+||||||+++..|.=.+ T Consensus 16 ~~L~~i~l~i~~Ge~~aivG~sGsGKSTLl~~l~G~~ 52 (178) T cd03247 16 QVLKNLSLELKQGEKIALLGRSGSGKSTLLQLLTGDL 52 (178) T ss_pred CCEECEEEEECCCCEEEEECCCCCHHHHHHHHHHHCC T ss_conf 6332558998699999999999875999999998617 No 339 >PRK11144 modC molybdate transporter ATP-binding protein; Provisional Probab=97.74 E-value=0.00021 Score=47.93 Aligned_cols=40 Identities=23% Similarity=0.516 Sum_probs=29.8 Q ss_pred EEEECCEEEEEEEEECCC-CEEEEECCCCCCHHHHHHHHHHHH Q ss_conf 999422789999887389-818998899978889999999871 Q gi|255764514|r 4 LSIYNIVLIESLDIDFSA-GLSILSGDTGSGKSILLDALILVT 45 (554) Q Consensus 4 L~i~Nf~~i~~~~i~f~~-Gl~vItGetGaGKS~ildAl~~~l 45 (554) .+.-+|.+ ++++++.+ ++++|.||||||||+++.+|.-+. T Consensus 8 ~~~g~f~l--dv~l~i~~g~i~~l~GpsGaGKTTLl~~iaGl~ 48 (352) T PRK11144 8 QQLGQLCL--TVNLTLPAQGITAIFGRSGAGKTSLINLISGLT 48 (352) T ss_pred EEECCEEE--EEEEEECCCCEEEEECCCCCHHHHHHHHHHCCC T ss_conf 99899999--999998899899999999962999999997689 No 340 >TIGR02169 SMC_prok_A chromosome segregation protein SMC; InterPro: IPR011891 The SMC (structural maintenance of chromosomes) family of proteins, exist in virtually all organisms including both bacteria and archaea. The SMC proteins are essential for successful chromosome transmission during replication and segregation of the genome in all organisms and form three types of heterodimer (SMC1SMC3, SMC2SMC4, SMC5SMC6), which are core components of large multiprotein complexes. The best known complexes are cohesin, which is responsible for sister-chromatid cohesion, and condensin, which is required for full chromosome condensation in mitosis. SMCs are generally present as single proteins in bacteria, and as at least six distinct proteins in eukaryotes. The proteins range in size from approximately 110 to 170 kDa, and share a five-domain structure, with globular N- and C-terminal (IPR003395 from INTERPRO) domains separated by a long (circa 100 nm or 900 residues) coiled coil segment in the centre of which is a globular ''hinge'' domain, characterised by a set of four highly conserved glycine residues that are typical of flexible regions in a protein. The amino-terminal domain contains a 'Walker A' nucleotide-binding domain (GxxGxGKS/T), which by mutational studies has been shown to be essential in several proteins. The carboxy-terminal domain contains a sequence (the DA-box) that resembles a 'Walker B' motif (XXXXD, where X is any hydrophobic residue), and a LSGG motif with homology to the signature sequence of the ATP-binding cassette (ABC) family of ATPases . All SMC proteins appear to form dimers, either forming homodimers with themselves, as in the case of prokaryotic SMC proteins, or heterodimers between different but related SMC proteins. The dimers are arranged in an antiparallel alignment. This orientation brings the N- and C-terminal globular domains (from either different or identical protamers) together, which unites an ATP binding site (Walker A motif) within the N-terminal domain with a Walker B motif (DA box) within the C-terminal domain, to form a potentially functional ATPase. Protein interaction and microscopy data suggest that SMC dimers form a ring-like structure which might embrace DNA molecules. Non-SMC subunits associate with the SMC amino- and carboxy-terminal domains. The sequence homology within the carboxy-terminal domain is relatively high within the SMC1-SMC4 group, whereas SMC5 and SMC6 show some divergence in both of these sequences. SMCs share not only sequence similarity but also structural similarity with ABC proteins. SMC proteins function together with other proteins in a range of chromosomal transactions, including chromosome condensation, sister-chromatid cohesion, recombination, DNA repair and epigenetic silencing of gene expression . This family represents the SMC protein of archaea and a few bacteria (Aquifex, Synechocystis, etc); the SMC of other bacteria is described by IPR011890 from INTERPRO. The N- and C-terminal domains of this protein are well conserved, but the central hinge region is skewed in composition and highly divergent .. Probab=97.74 E-value=0.0041 Score=39.48 Aligned_cols=183 Identities=18% Similarity=0.268 Sum_probs=136.3 Q ss_pred HHHHHHHHHHCCHHHHHHH-----------HHHHHHHHHHHHHHHHHHHHHHH---HHHHHHHHHHH-HHHHHHHHHHHH Q ss_conf 1568887520000266644-----------33457777788888767652111---36678999999-988899999766 Q gi|255764514|r 316 IDQLPELAKKMEEDLADIS-----------EGNEKVVSLERVLYEARQAYDRV---AQDISTKRYQF-AKMLEKNVMAEM 380 (554) Q Consensus 316 ~eel~~~~~~l~~~l~~l~-----------~~~~~l~~l~~~~~~~~~~l~~~---a~~Ls~~R~~~-a~~L~~~i~~~L 380 (554) ++.|....+++..++..|. ....++.+|+.+...|..+-..+ -..+...++.+ ...| .+||..| T Consensus 990 ~~~v~~~~~~~~~~~~~LepVNm~AI~eYe~~~~r~~eL~~K~~~L~~Er~~i~~rI~~~e~~Kr~~F~~aF-~~IN~~f 1068 (1202) T TIGR02169 990 LEKVQKELQRVEEEIRALEPVNMLAIQEYEEVEKRLDELKEKRAKLEEEREEILERIEEYEKKKREVFMEAF-EAINENF 1068 (1202) T ss_pred HHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-HHHHHHH T ss_conf 689999999999998641430143322179999998769999999999899999999998878899999999-9999999 Q ss_pred HHHC--CC-CCEEEEEEECCCCCCCCCCCCCCEEEEECCCCCCCCHHHHHHCCHHHHHHHHHHHHHHCCCCCCCEEEEEC Q ss_conf 6520--25-63378652025322344654320011012789983113544062157999999999843668997699803 Q gi|255764514|r 381 PALK--LE-NVCFTVNITSDKEDISPDGIDRVEFYVQTNRGENPGPLMKLASGGELSRFLLALKIVLVDQGSIPTLVFDE 457 (554) Q Consensus 381 ~~L~--m~-~a~f~i~~~~~~~~~~~~G~d~v~f~~s~n~g~~~~pl~kiaSGGE~Sr~~LAl~~~~~~~~~~p~~ifDE 457 (554) +... +. +|.....+.. |++|..+| +++-+.| .|+|.+-|. -+||||||.++|||.||++.+.|+|||.||| T Consensus 1069 ~~iF~~LSP~G~g~L~Le~-PdDPF~GG---l~l~a~P-~~K~vqrle-AMSGGEKSLtALsFIFAiQ~y~PsPFYafDE 1142 (1202) T TIGR02169 1069 KEIFAELSPGGTGELILEN-PDDPFAGG---LELKAKP-KGKPVQRLE-AMSGGEKSLTALSFIFAIQRYKPSPFYAFDE 1142 (1202) T ss_pred HHHHHHHCCCCCEEEECCC-CCCCCCCC---CEEEEEE-CCCCEEEHH-HCCCCHHHHHHHHHHHHHHHCCCCCCHHHHH T ss_conf 9999853889824654358-88743687---1788873-788502022-1038389999999999996218985404446 Q ss_pred CCCCCCHHHHHHHHHHHHHHHHCCCEEEEECHHHHHHHCCCEEEEEEE Q ss_conf 446888799999999999973059399980837986501761799996 Q gi|255764514|r 458 VDSGIGGAVADAIGYRLKQLSKKIQLLAVTHAPQVAARADRHFLVYKT 505 (554) Q Consensus 458 iDagi~G~~a~~v~~~l~~ls~~~Qvi~ITH~pqvAa~a~~h~~v~K~ 505 (554) ||+.++|.||.+||+|+++.|+.+|||||||---|-.+||+=+-|.=. T Consensus 1143 VDmfLD~~Nverva~li~~~s~~AQFIVvSLR~~m~~~A~~~IGVT~~ 1190 (1202) T TIGR02169 1143 VDMFLDGVNVERVAKLIKEKSKEAQFIVVSLRKPMIEAADRAIGVTMR 1190 (1202) T ss_pred HHHHHHHHHHHHHHHHHHHHCCCEEEEEEECCHHHHHHHHHHHHHHHH T ss_conf 777751875999999998604863467776235899876456544430 No 341 >cd03237 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 of RNase L inhibitor. The ABC ATPase, RNase L inhibitor (RLI), is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids. RLI's are not transport proteins and thus cluster with a group of soluble proteins that lack the transmembrane components commonly found in other members of the family. Structurally, RLI's have an N-terminal Fe-S domain and two nucleotide-binding domains which are arranged to form two composite active sites in their interface cleft. RLI is one of the most conserved enzymes between archaea and eukaryotes with a sequence identity of more than 48%. The high degree of evolutionary conservation suggests that RLI performs a central role in archaeal and eukaryotic physiology. Probab=97.74 E-value=4.3e-05 Score=52.54 Aligned_cols=35 Identities=20% Similarity=0.377 Sum_probs=27.7 Q ss_pred EEEEEEEECCCC------EEEEECCCCCCHHHHHHHHHHHH Q ss_conf 899998873898------18998899978889999999871 Q gi|255764514|r 11 LIESLDIDFSAG------LSILSGDTGSGKSILLDALILVT 45 (554) Q Consensus 11 ~i~~~~i~f~~G------l~vItGetGaGKS~ildAl~~~l 45 (554) .+++++++..+| +++|+||||||||+++..|.-++ T Consensus 9 ~l~~~sL~i~~Gti~~GEiv~liGpNGaGKSTLlk~l~Gll 49 (246) T cd03237 9 TLGEFTLEVEGGSISESEVIGILGPNGIGKTTFIKMLAGVL 49 (246) T ss_pred ECCEEEEEECCCCCCCCCEEEEECCCCCHHHHHHHHHHCCC T ss_conf 61506898568846579899999799976999999997787 No 342 >TIGR01978 sufC FeS assembly ATPase SufC; InterPro: IPR010230 Iron-sulphur (FeS) clusters are important cofactors for numerous proteins involved in electron transfer, in redox and non-redox catalysis, in gene regulation, and as sensors of oxygen and iron. These functions depend on the various FeS cluster prosthetic groups, the most common being [2Fe-2S] and [4Fe-4S] . FeS cluster assembly is a complex process involving the mobilisation of Fe and S atoms from storage sources, their assembly into [Fe-S] form, their transport to specific cellular locations, and their transfer to recipient apoproteins. So far, three FeS assembly machineries have been identified, which are capable of synthesising all types of [Fe-S] clusters: ISC (iron-sulphur cluster), SUF (sulphur assimilation), and NIF (nitrogen fixation) systems. The ISC system is conserved in eubacteria and eukaryotes (mitochondria), and has broad specificity, targeting general FeS proteins , . It is encoded by the isc operon (iscRSUA-hscBA-fdx-iscX). IscS is a cysteine desulphurase, which obtains S from cysteine (converting it to alanine) and serves as a S donor for FeS cluster assembly. IscU and IscA act as scaffolds to accept S and Fe atoms, assembling clusters and transfering them to recipient apoproteins. HscA is a molecular chaperone and HscB is a co-chaperone. Fdx is a [2Fe-2S]-type ferredoxin. IscR is a transcription factor that regulates expression of the isc operon. IscX (also known as YfhJ) appears to interact with IscS and may function as an Fe donor during cluster assembly . The SUF system is an alternative pathway to the ISC system that operates under iron starvation and oxidative stress. It is found in eubacteria, archaea and eukaryotes (plastids). The SUF system is encoded by the suf operon (sufABCDSE), and the six encoded proteins are arranged into two complexes (SufSE and SufBCD) and one protein (SufA). SufS is a pyridoxal-phosphate (PLP) protein displaying cysteine desulphurase activity. SufE acts as a scaffold protein that accepts S from SufS and donates it to SufA . SufC is an ATPase with an unorthodox ATP-binding cassette (ABC)-like component. No specific functions have been assigned to SufB and SufD. SufA is homologous to IscA , acting as a scaffold protein in which Fe and S atoms are assembled into [FeS] cluster forms, which can then easily be transferred to apoproteins targets. In the NIF system, NifS and NifU are required for the formation of metalloclusters of nitrogenase in Azotobacter vinelandii, and other organisms, as well as in the maturation of other FeS proteins. Nitrogenase catalyses the fixation of nitrogen. It contains a complex cluster, the FeMo cofactor, which contains molybdenum, Fe and S. NifS is a cysteine desulphurase. NifU binds one Fe atom at its N-terminal, assembling an FeS cluster that is transferred to nitrogenase apoproteins . Nif proteins involved in the formation of FeS clusters can also be found in organisms that do not fix nitrogen . This entry represents SufC, which acts as an ATPase in the SUF system. SufC belongs to the ATP-binding cassette transporter family (IPR003439 from INTERPRO) but is no longer thought to be part of a transporter. The complex is reported as cytosolic or associated with the membrane.; GO: 0005524 ATP binding, 0006810 transport. Probab=97.74 E-value=2.5e-05 Score=54.13 Aligned_cols=39 Identities=23% Similarity=0.520 Sum_probs=29.7 Q ss_pred EECCEEEEEEEEECCCC-EEEEECCCCCCHHHHHHHHHHHHCC Q ss_conf 94227899998873898-1899889997888999999987147 Q gi|255764514|r 6 IYNIVLIESLDIDFSAG-LSILSGDTGSGKSILLDALILVTGG 47 (554) Q Consensus 6 i~Nf~~i~~~~i~f~~G-l~vItGetGaGKS~ildAl~~~lG~ 47 (554) |.+=.+.+.++|+-.+| +.||=||||||||+|..+ +.|. T Consensus 10 ~edk~IL~gvnL~v~~GE~HAiMGPNGsGKSTL~~~---iaGh 49 (248) T TIGR01978 10 VEDKEILKGVNLTVKKGEIHAIMGPNGSGKSTLSKT---IAGH 49 (248) T ss_pred ECCEECCCCCCCCCCCCEEEEEECCCCCCHHHHHHH---HHCC T ss_conf 778861678676216851799868899847888777---6179 No 343 >cd03292 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane. The FtsE/X transporter is thought to be involved in cell division and is important for assembly or stability of the septal ring. Probab=97.74 E-value=5.6e-05 Score=51.77 Aligned_cols=37 Identities=32% Similarity=0.570 Sum_probs=30.9 Q ss_pred CCEEEEEEEEECCCC-EEEEECCCCCCHHHHHHHHHHH Q ss_conf 227899998873898-1899889997888999999987 Q gi|255764514|r 8 NIVLIESLDIDFSAG-LSILSGDTGSGKSILLDALILV 44 (554) Q Consensus 8 Nf~~i~~~~i~f~~G-l~vItGetGaGKS~ildAl~~~ 44 (554) ++...+++++++.+| |.+|+||+|||||+++..|+-+ T Consensus 13 ~~~aL~~vsl~i~~Ge~v~i~GpSGsGKSTLl~~i~gl 50 (214) T cd03292 13 GTAALDGINISISAGEFVFLVGPSGAGKSTLLKLIYKE 50 (214) T ss_pred CCEEEEEEEEEECCCCEEEEECCCCCHHHHHHHHHHCC T ss_conf 98998221779859989999979995399999999629 No 344 >cd03300 ABC_PotA_N PotA is an ABC-type transporter and the ATPase component of the spermidine/putrescine-preferential uptake system consisting of PotA, -B, -C, and -D. PotA has two domains with the N-terminal domain containing the ATPase activity and the residues required for homodimerization with PotA and heterdimerization with PotB. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins. Probab=97.73 E-value=4.2e-05 Score=52.61 Aligned_cols=38 Identities=26% Similarity=0.461 Sum_probs=31.2 Q ss_pred ECCEEEEEEEEECCCC-EEEEECCCCCCHHHHHHHHHHH Q ss_conf 4227899998873898-1899889997888999999987 Q gi|255764514|r 7 YNIVLIESLDIDFSAG-LSILSGDTGSGKSILLDALILV 44 (554) Q Consensus 7 ~Nf~~i~~~~i~f~~G-l~vItGetGaGKS~ildAl~~~ 44 (554) -+...++++++++.+| +.+|.||||||||+++..|.-+ T Consensus 11 g~~~vl~~vsl~v~~Ge~~~iiGpSGsGKSTllr~i~Gl 49 (232) T cd03300 11 GGFVALDGVSLDIKEGEFFTLLGPSGCGKTTLLRLIAGF 49 (232) T ss_pred CCEEEECCCEEEECCCCEEEEECCCCCHHHHHHHHHHCC T ss_conf 998898761748879989999999998399999999779 No 345 >TIGR03410 urea_trans_UrtE urea ABC transporter, ATP-binding protein UrtE. Members of this protein family are ABC transporter ATP-binding subunits associated with urea transport and metabolism. This protein is found in a conserved five-gene transport operon typically found adjacent to urease genes. It was shown in Cyanobacteria that disruption leads to the loss of high-affinity urea transport activity. Probab=97.73 E-value=6.3e-05 Score=51.44 Aligned_cols=37 Identities=22% Similarity=0.504 Sum_probs=30.6 Q ss_pred CCEEEEEEEEECCCC-EEEEECCCCCCHHHHHHHHHHH Q ss_conf 227899998873898-1899889997888999999987 Q gi|255764514|r 8 NIVLIESLDIDFSAG-LSILSGDTGSGKSILLDALILV 44 (554) Q Consensus 8 Nf~~i~~~~i~f~~G-l~vItGetGaGKS~ildAl~~~ 44 (554) ++..+++++++..+| +.+|.||||||||+++..|.=+ T Consensus 12 ~~~~L~~vs~~v~~Gei~~liGpNGaGKSTL~~~i~Gl 49 (230) T TIGR03410 12 QSHILRGVSLEVPKGEVTCVLGRNGVGKTTLLKTLMGL 49 (230) T ss_pred CEEEECCEEEEECCCCEEEEECCCCCHHHHHHHHHHCC T ss_conf 96688871779999979999999994099999999779 No 346 >PRK10636 putative ABC transporter ATP-binding protein; Provisional Probab=97.73 E-value=0.00022 Score=47.83 Aligned_cols=33 Identities=36% Similarity=0.507 Sum_probs=28.4 Q ss_pred EEEEEEEEECCCC-EEEEECCCCCCHHHHHHHHH Q ss_conf 7899998873898-18998899978889999999 Q gi|255764514|r 10 VLIESLDIDFSAG-LSILSGDTGSGKSILLDALI 42 (554) Q Consensus 10 ~~i~~~~i~f~~G-l~vItGetGaGKS~ildAl~ 42 (554) .+++++++.+.+| ..+|+|+||||||+|+..|. T Consensus 15 ~ll~~vsl~I~~Ge~vgLVG~NGsGKSTLlklL~ 48 (638) T PRK10636 15 VLLDNATATINPGQKVGLVGKNGCGKSTLLALLK 48 (638) T ss_pred EEEECCEEEECCCCEEEEECCCCCHHHHHHHHHC T ss_conf 8986767999899899998899988999999980 No 347 >TIGR01420 pilT_fam twitching motility protein; InterPro: IPR006321 These represent the PilT subfamily of proteins related to GspE, a protein involved in type II secretion (also called the General Secretion Pathway). PilT is an apparent cytosolic ATPase associated with type IV pilus systems. It is not required for pilin biogenesis, but is required for twitching motility and social gliding behaviors, shown in some species, powered by pilus retraction . Members of this family may be found in some species that do not have type IV pili but have related structures for DNA uptake and natural transformation. ; GO: 0005524 ATP binding, 0006810 transport. Probab=97.73 E-value=2.3e-05 Score=54.26 Aligned_cols=27 Identities=41% Similarity=0.597 Sum_probs=22.4 Q ss_pred CCCEEEEECCCCCCHHHHHHHHHHHHC Q ss_conf 898189988999788899999998714 Q gi|255764514|r 20 SAGLSILSGDTGSGKSILLDALILVTG 46 (554) Q Consensus 20 ~~Gl~vItGetGaGKS~ildAl~~~lG 46 (554) ..||..+|||||||||+-|-||-=-.- T Consensus 126 ~~GLiLVTGPTGSGKSTTlAsmIDyIN 152 (350) T TIGR01420 126 PRGLILVTGPTGSGKSTTLASMIDYIN 152 (350) T ss_pred CCCCEEEECCCCCCHHHHHHHHHHHHH T ss_conf 699389876889867899999997874 No 348 >PRK10851 sulfate/thiosulfate transporter subunit; Provisional Probab=97.73 E-value=0.00022 Score=47.80 Aligned_cols=36 Identities=28% Similarity=0.555 Sum_probs=30.7 Q ss_pred CEEEEEEEEECCCC-EEEEECCCCCCHHHHHHHHHHH Q ss_conf 27899998873898-1899889997888999999987 Q gi|255764514|r 9 IVLIESLDIDFSAG-LSILSGDTGSGKSILLDALILV 44 (554) Q Consensus 9 f~~i~~~~i~f~~G-l~vItGetGaGKS~ildAl~~~ 44 (554) ...++++++++.+| +.+|.||||||||+++..|.-+ T Consensus 15 ~~al~~vsl~i~~GE~~~llGpSGsGKSTLlr~iaGL 51 (352) T PRK10851 15 TQVLNDISLDIPSGQMVALLGPSGSGKTTLLRIIAGL 51 (352) T ss_pred EEEEECCEEEECCCCEEEEECCCCCHHHHHHHHHHCC T ss_conf 9999063769999989999999984699999999769 No 349 >COG3839 MalK ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] Probab=97.73 E-value=4.8e-05 Score=52.23 Aligned_cols=35 Identities=29% Similarity=0.601 Sum_probs=30.2 Q ss_pred EEEEEEEECCCC-EEEEECCCCCCHHHHHHHHHHHH Q ss_conf 899998873898-18998899978889999999871 Q gi|255764514|r 11 LIESLDIDFSAG-LSILSGDTGSGKSILLDALILVT 45 (554) Q Consensus 11 ~i~~~~i~f~~G-l~vItGetGaGKS~ildAl~~~l 45 (554) .++++++++.+| |.||.||||||||++|..|.-+. T Consensus 18 ~l~~i~l~i~~Gef~vllGPSGcGKSTlLr~IAGLe 53 (338) T COG3839 18 VLKDVNLDIEDGEFVVLLGPSGCGKSTLLRMIAGLE 53 (338) T ss_pred EEECCEEEECCCCEEEEECCCCCCHHHHHHHHHCCC T ss_conf 563326897479799998999888899999996887 No 350 >TIGR02324 CP_lyasePhnL phosphonate C-P lyase system protein PhnL; InterPro: IPR012701 Members of this family are the PhnL protein of C-P lyase systems for utilization of phosphonates. These systems resemble phosphonatase-based systems in having a three-component ABC transporter, where IPR005769 from INTERPRO is the permease, IPR005770 from INTERPRO is the phosphonates binding protein, and IPR012693 from INTERPRO is the ATP-binding cassette (ABC) protein. They differ, however, in having, typically, ten or more additional genes, many of which are believed to form a membrane-associated C-P lyase complex. This protein (PhnL) and the adjacent-encoded PhnK (IPR012700 from INTERPRO) resemble transporter ATP-binding proteins but are suggested, based on mutagenesis studies, to be part of this C-P lyase complex rather than part of a transporter per se .. Probab=97.73 E-value=2.7e-05 Score=53.83 Aligned_cols=32 Identities=38% Similarity=0.657 Sum_probs=27.1 Q ss_pred EEEEEEEEECCCC-EEEEECCCCCCHHHHHHHH Q ss_conf 7899998873898-1899889997888999999 Q gi|255764514|r 10 VLIESLDIDFSAG-LSILSGDTGSGKSILLDAL 41 (554) Q Consensus 10 ~~i~~~~i~f~~G-l~vItGetGaGKS~ildAl 41 (554) -.++++++...+| +.++.|++|||||+||-+| T Consensus 22 pVl~~v~l~V~aGEcv~L~G~SGaGKSTlLk~l 54 (224) T TIGR02324 22 PVLKNVSLTVNAGECVALSGPSGAGKSTLLKSL 54 (224) T ss_pred EECCCCEEEEECCCEEEEECCCCCCHHHHHHHH T ss_conf 000674378736735885368887678999976 No 351 >cd03253 ABCC_ATM1_transporter ATM1 is an ABC transporter that is expressed in the mitochondria. Although the specific function of ATM1 is unknown, its disruption results in the accumulation of excess mitochondrial iron, loss of mitochondrial cytochromes, oxidative damage to mitochondrial DNA, and decreased levels of cytosolic heme proteins. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins. Probab=97.73 E-value=4.3e-05 Score=52.50 Aligned_cols=33 Identities=30% Similarity=0.546 Sum_probs=28.8 Q ss_pred EEEEEEEEECCCC-EEEEECCCCCCHHHHHHHHH Q ss_conf 7899998873898-18998899978889999999 Q gi|255764514|r 10 VLIESLDIDFSAG-LSILSGDTGSGKSILLDALI 42 (554) Q Consensus 10 ~~i~~~~i~f~~G-l~vItGetGaGKS~ildAl~ 42 (554) ..++++++.+.+| +.+|+|+||||||+++..|. T Consensus 15 ~iL~~isl~i~~Ge~v~ivG~sGsGKSTLl~ll~ 48 (236) T cd03253 15 PVLKDVSFTIPAGKKVAIVGPSGSGKSTILRLLF 48 (236) T ss_pred CEEECEEEEECCCCEEEEECCCCCCHHHHHHHHC T ss_conf 6330568998699999999999998999999974 No 352 >PRK09700 D-allose transporter ATP-binding protein; Provisional Probab=97.73 E-value=0.00039 Score=46.18 Aligned_cols=35 Identities=29% Similarity=0.532 Sum_probs=29.3 Q ss_pred EEEEEEEEECCCC-EEEEECCCCCCHHHHHHHHHHH Q ss_conf 7899998873898-1899889997888999999987 Q gi|255764514|r 10 VLIESLDIDFSAG-LSILSGDTGSGKSILLDALILV 44 (554) Q Consensus 10 ~~i~~~~i~f~~G-l~vItGetGaGKS~ildAl~~~ 44 (554) ...+++++++.+| +.+|+||||||||+++.+|+-+ T Consensus 19 ~aL~~vsl~i~~GEi~~liG~nGaGKSTL~~~l~G~ 54 (510) T PRK09700 19 HALKSVNLTVYPGEIHALLGENGAGKSTLMKVLSGI 54 (510) T ss_pred EEECCEEEEECCCCEEEEECCCCCHHHHHHHHHHCC T ss_conf 897662889989969999899997299999998379 No 353 >PRK10908 cell division protein FtsE; Provisional Probab=97.72 E-value=4.3e-05 Score=52.53 Aligned_cols=36 Identities=25% Similarity=0.550 Sum_probs=30.4 Q ss_pred EEEEEEEEECCCC-EEEEECCCCCCHHHHHHHHHHHH Q ss_conf 7899998873898-18998899978889999999871 Q gi|255764514|r 10 VLIESLDIDFSAG-LSILSGDTGSGKSILLDALILVT 45 (554) Q Consensus 10 ~~i~~~~i~f~~G-l~vItGetGaGKS~ildAl~~~l 45 (554) ..++++++++.+| +.+|+||||||||+++..|+-++ T Consensus 16 ~~L~~vsl~i~~Ge~~~liG~nGsGKSTLl~~i~Gl~ 52 (222) T PRK10908 16 QALQGVTFHMRPGEMAFLTGHSGAGKSTLLKLICGIE 52 (222) T ss_pred EEEECCEEEECCCCEEEEECCCCCHHHHHHHHHHCCC T ss_conf 7986438799699899999999807999999996599 No 354 >PRK11308 dppF dipeptide transporter ATP-binding subunit; Provisional Probab=97.72 E-value=0.00034 Score=46.57 Aligned_cols=72 Identities=24% Similarity=0.334 Sum_probs=55.1 Q ss_pred HCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHC--CCEEEEECHHHHHH-HCCCEEEEE Q ss_conf 06215799999999984366899769980344688879999999999997305--93999808379865-017617999 Q gi|255764514|r 428 ASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSKK--IQLLAVTHAPQVAA-RADRHFLVY 503 (554) Q Consensus 428 aSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~~--~Qvi~ITH~pqvAa-~a~~h~~v~ 503 (554) +|||++=|+++|..++. ...++|+||.=++++-.+...|-++|++|-+. .=+|.|||---+|+ .||+=.+.+ T Consensus 155 LSGGq~QRv~IArAL~~----~P~lLi~DEPTsaLD~~~q~~Il~ll~~l~~~~~~t~l~ITHDl~~v~~iaDri~VMy 229 (327) T PRK11308 155 FSGGQRQRIAIARALML----DPDVVVADEPVSALDVSVQAQVLNLMMDLQQELGLSYVFISHDLSVVEHIADDVMVMY 229 (327) T ss_pred CCHHHHHHHHHHHHHHC----CCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHCCCEEEEECCCHHHHHHHCCEEEEEE T ss_conf 79999999999999842----8989998478654699999999999999997009769998698999998699899998 No 355 >cd03301 ABC_MalK_N The N-terminal ATPase domain of the maltose transporter, MalK. ATP binding cassette (ABC) proteins function from bacteria to human, mediating the translocation of substances into and out of cells or organelles. ABC transporters contain two transmembrane-spanning domains (TMDs) or subunits and two nucleotide binding domains (NBDs) or subunits that couple transport to the hydrolysis of ATP. In the maltose transport system, the periplasmic maltose binding protein (MBP) stimulates the ATPase activity of the membrane-associated transporter, which consists of two transmembrane subunits, MalF and MalG, and two copies of the ATP binding subunit, MalK, and becomes tightly bound to the transporter in the catalytic transition state, ensuring that maltose is passed to the transporter as ATP is hydrolyzed. Probab=97.72 E-value=0.00036 Score=46.41 Aligned_cols=72 Identities=29% Similarity=0.342 Sum_probs=57.3 Q ss_pred HCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHC--CCEEEEECHHHHH-HHCCCEEEEEE Q ss_conf 06215799999999984366899769980344688879999999999997305--9399980837986-50176179999 Q gi|255764514|r 428 ASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSKK--IQLLAVTHAPQVA-ARADRHFLVYK 504 (554) Q Consensus 428 aSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~~--~Qvi~ITH~pqvA-a~a~~h~~v~K 504 (554) +||||+-|+++|=.++. .++.++|||.=++++-.+...+-+.++++-+. .=+|.|||-+-.| ..||+ +.|-+ T Consensus 131 LSGGqkQRVaiARAl~~----~P~lLLlDEP~saLD~~~r~~i~~~l~~~~~~~~~T~i~vTHd~~ea~~l~dr-i~vm~ 205 (213) T cd03301 131 LSGGQRQRVALGRAIVR----EPKVFLMDEPLSNLDAKLRVQMRAELKRLQQRLGTTTIYVTHDQVEAMTMADR-IAVMN 205 (213) T ss_pred CCHHHHHHHHHHHHHHC----CCCEEEECCCCCCCCHHHHHHHHHHHHHHHHHHCCEEEEECCCHHHHHHHCCE-EEEEE T ss_conf 99999999999999875----99989983887642989999999999999997499899999998999996998-99998 No 356 >PRK10851 sulfate/thiosulfate transporter subunit; Provisional Probab=97.72 E-value=4.9e-05 Score=52.16 Aligned_cols=73 Identities=27% Similarity=0.361 Sum_probs=59.8 Q ss_pred HCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCC--CEEEEECHHHHH-HHCCCEEEEEE Q ss_conf 062157999999999843668997699803446888799999999999973059--399980837986-50176179999 Q gi|255764514|r 428 ASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSKKI--QLLAVTHAPQVA-ARADRHFLVYK 504 (554) Q Consensus 428 aSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~~~--Qvi~ITH~pqvA-a~a~~h~~v~K 504 (554) +|||++=|+++|-.++. .+..++|||.=++++-.+...+-+.|++|-+.. =+|.|||-+-.| ..||+=++..+ T Consensus 137 LSGGqrQRVaiARAL~~----~P~vLLLDEPts~LD~~~r~~i~~~l~~L~~e~g~T~i~VTHD~~eA~~laDrI~Vm~~ 212 (352) T PRK10851 137 LSGGQKQRVALARALAV----EPQILLLDEPFGALDAQVRKELRRWLRQLHEELKFTSVFVTHDQEEAMEVADRVVVMSQ 212 (352) T ss_pred CCHHHHHHHHHHHHHHC----CCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHHCCEEEEECCCHHHHHHHCCEEEEEEC T ss_conf 99999999999999865----99999990887668989999999999999997399899998899999986989999989 No 357 >cd03215 ABC_Carb_Monos_II This family represents domain II of the carbohydrate uptake proteins that transport only monosaccharides (Monos). The Carb_Monos family is involved in the uptake of monosaccharides, such as pentoses (such as xylose, arabinose, and ribose) and hexoses (such as xylose, arabinose, and ribose), that cannot be broken down to simple sugars by hydrolysis. In members of Carb_Monos family the single hydrophobic gene product forms a homodimer, while the ABC protein represents a fusion of two nucleotide-binding domains. However, it is assumed that two copies of the ABC domains are present in the assembled transporter. Probab=97.72 E-value=3.9e-05 Score=52.77 Aligned_cols=42 Identities=21% Similarity=0.427 Sum_probs=33.6 Q ss_pred EEEECCE---EEEEEEEECCCC-EEEEECCCCCCHHHHHHHHHHHH Q ss_conf 9994227---899998873898-18998899978889999999871 Q gi|255764514|r 4 LSIYNIV---LIESLDIDFSAG-LSILSGDTGSGKSILLDALILVT 45 (554) Q Consensus 4 L~i~Nf~---~i~~~~i~f~~G-l~vItGetGaGKS~ildAl~~~l 45 (554) |.++|+- .+++++++..+| +.+|+||||||||+++.+|.-++ T Consensus 5 l~v~~ls~~~aL~~vsl~v~~GEi~~liG~nGaGKSTll~~l~G~~ 50 (182) T cd03215 5 LEVRGLSVKGAVRDVSFEVRAGEIVGIAGLVGNGQTELAEALFGLR 50 (182) T ss_pred EEEECCCCCCCEECEEEEECCCCEEEEECCCCCCCCHHHHHHCCCC T ss_conf 9997980678762317898599699998889999263778766986 No 358 >PRK13643 cbiO cobalt transporter ATP-binding subunit; Provisional Probab=97.72 E-value=4.3e-05 Score=52.50 Aligned_cols=35 Identities=37% Similarity=0.530 Sum_probs=29.7 Q ss_pred EEEEEEEECCCC-EEEEECCCCCCHHHHHHHHHHHH Q ss_conf 899998873898-18998899978889999999871 Q gi|255764514|r 11 LIESLDIDFSAG-LSILSGDTGSGKSILLDALILVT 45 (554) Q Consensus 11 ~i~~~~i~f~~G-l~vItGetGaGKS~ildAl~~~l 45 (554) .+++++++..+| |++|+|+||||||+++..|+-++ T Consensus 21 aL~dIsl~I~~Ge~vaiiG~nGsGKSTLl~~l~Gll 56 (288) T PRK13643 21 ALFDIDLEVKKGSYTALIGHTGSGKSTLLQHLNGLL 56 (288) T ss_pred EEEEEEEEECCCCEEEEECCCCCHHHHHHHHHHCCC T ss_conf 366336798599899999999947999999997488 No 359 >cd03294 ABC_Pro_Gly_Bertaine This family comprises the glycine betaine/L-proline ATP binding subunit in bacteria and its equivalents in archaea. This transport system belong to the larger ATP-Binding Cassette (ABC) transporter superfamily. The characteristic feature of these transporters is the obligatory coupling of ATP hydrolysis to substrate translocation. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins. Probab=97.71 E-value=0.00044 Score=45.85 Aligned_cols=72 Identities=24% Similarity=0.256 Sum_probs=59.3 Q ss_pred HCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHC--CCEEEEECHHHHHH-HCCCEEEEE Q ss_conf 06215799999999984366899769980344688879999999999997305--93999808379865-017617999 Q gi|255764514|r 428 ASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSKK--IQLLAVTHAPQVAA-RADRHFLVY 503 (554) Q Consensus 428 aSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~~--~Qvi~ITH~pqvAa-~a~~h~~v~ 503 (554) +|||+.=|+++|-.++. .++.+++||.=++++-.+...+-+.|+++.+. .=+|+|||-+-.|. .||+=.+.. T Consensus 161 LSGGq~QRVaIARALa~----~P~iLLlDEPtsaLD~~~~~~i~~~l~~l~~~~~~T~i~VTHD~~eA~~laDrI~vm~ 235 (269) T cd03294 161 LSGGMQQRVGLARALAV----DPDILLMDEAFSALDPLIRREMQDELLRLQAELQKTIVFITHDLDEALRLGDRIAIMK 235 (269) T ss_pred HCHHHHHHHHHHHHHHC----CCCEEEECCCCCCCCHHHHHHHHHHHHHHHHHHCCEEEEECCCHHHHHHHCCEEEEEE T ss_conf 49488889999999863----9989997587542599999999999999999749999999998999999799899998 No 360 >COG4133 CcmA ABC-type transport system involved in cytochrome c biogenesis, ATPase component [Posttranslational modification, protein turnover, chaperones] Probab=97.71 E-value=4.5e-05 Score=52.36 Aligned_cols=36 Identities=31% Similarity=0.493 Sum_probs=30.6 Q ss_pred EEEEEEEEECCCC-EEEEECCCCCCHHHHHHHHHHHH Q ss_conf 7899998873898-18998899978889999999871 Q gi|255764514|r 10 VLIESLDIDFSAG-LSILSGDTGSGKSILLDALILVT 45 (554) Q Consensus 10 ~~i~~~~i~f~~G-l~vItGetGaGKS~ildAl~~~l 45 (554) .++.++++.|.+| +.+|||+||||||++|..|.-++ T Consensus 16 ~lf~~L~f~l~~Ge~~~i~G~NG~GKTtLLRilaGLl 52 (209) T COG4133 16 TLFSDLSFTLNAGEALQITGPNGAGKTTLLRILAGLL 52 (209) T ss_pred EEECCEEEEECCCCEEEEECCCCCCHHHHHHHHHCCC T ss_conf 0212304787488779998999875889999997126 No 361 >cd03266 ABC_NatA_sodium_exporter NatA is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled proton or K+ uptake. NatB possess six putative membrane spanning regions at its C-terminus. In B. subtilus, NatAB is inducible by agents such as ethanol and protonophores, which lower the protonmotive force across the membrane. The closest sequence similarity to NatA is exhibited by DrrA of the two-component daunomycin- and doxorubicin-efflux system. Hence, the functional NatAB is presumably assembled with two copies of a single ATP-binding protein and a single intergral membrane protein. Probab=97.71 E-value=5.7e-05 Score=51.70 Aligned_cols=36 Identities=22% Similarity=0.375 Sum_probs=30.6 Q ss_pred EEEEEEEEECCCC-EEEEECCCCCCHHHHHHHHHHHH Q ss_conf 7899998873898-18998899978889999999871 Q gi|255764514|r 10 VLIESLDIDFSAG-LSILSGDTGSGKSILLDALILVT 45 (554) Q Consensus 10 ~~i~~~~i~f~~G-l~vItGetGaGKS~ildAl~~~l 45 (554) ..++++++++.+| +.+|.||||||||+++..|+=++ T Consensus 19 ~al~~vs~~i~~Gei~gllG~NGaGKSTllk~i~Gl~ 55 (218) T cd03266 19 QAVDGVSFTVKPGEVTGLLGPNGAGKTTTLRMLAGLL 55 (218) T ss_pred EEEECCEEEECCCCEEEEECCCCCCHHHHHHHHHCCC T ss_conf 9872627898598299999999984999999997797 No 362 >PRK00635 excinuclease ABC subunit A; Provisional Probab=97.71 E-value=0.00025 Score=47.44 Aligned_cols=75 Identities=24% Similarity=0.281 Sum_probs=48.8 Q ss_pred HHCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHH-CCCEEEEECHHHHHHHCCCEEEE Q ss_conf 40621579999999998436689976998034468887999999999999730-59399980837986501761799 Q gi|255764514|r 427 LASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSK-KIQLLAVTHAPQVAARADRHFLV 502 (554) Q Consensus 427 iaSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~-~~Qvi~ITH~pqvAa~a~~h~~v 502 (554) .+||||.=|+=||-.+.- .......|||||--+|+-=.-..++-..|.+|-. -+=||||-|-..|...||.=+=+ T Consensus 809 TLSGGEaQRiKLa~eL~~-~~~~~tlyilDEPTtGLH~~Di~~Ll~~l~~Lv~~G~tviviEHnldvi~~aD~iIDl 884 (1809) T PRK00635 809 SLSGGEIQRLKLAYELLA-PSKKPTLYVLDEPTTGLHTHDIKALIEVLQSLTYQGHTVVIIEHNMHVVKVADYVLEL 884 (1809) T ss_pred CCCHHHHHHHHHHHHHHC-CCCCCEEEEECCCCCCCCHHHHHHHHHHHHHHHHCCCEEEEEECCHHHHHHCCEEEEC T ss_conf 766499999999999734-5889849997699878898999999999999986899799994788888648889974 No 363 >PRK11144 modC molybdate transporter ATP-binding protein; Provisional Probab=97.71 E-value=9.2e-05 Score=50.34 Aligned_cols=74 Identities=22% Similarity=0.275 Sum_probs=58.6 Q ss_pred HHCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCC--EEEEECHHH-HHHHCCCEEEEE Q ss_conf 40621579999999998436689976998034468887999999999999730593--999808379-865017617999 Q gi|255764514|r 427 LASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSKKIQ--LLAVTHAPQ-VAARADRHFLVY 503 (554) Q Consensus 427 iaSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~~~Q--vi~ITH~pq-vAa~a~~h~~v~ 503 (554) -+||||+=|+++|-.++. .+..+++||-=+|++-.....+-.+|+++.+... +|.|||-.. ++..||+=+... T Consensus 128 ~LSGGq~QRvaiARAL~~----~P~lLllDEP~s~LD~~~~~~i~~~l~~l~~~~~~til~VTHd~~e~~~laD~v~vm~ 203 (352) T PRK11144 128 SLSGGEKQRVAIGRALLT----APELLLMDEPLASLDLPRKRELLPYLERLAQEINIPILYVSHSLDEILRLADHVVVLE 203 (352) T ss_pred HCCCCHHHHHHHHHHHHC----CCCEEEECCCCCCCCHHHHHHHHHHHHHHHHHHCCEEEEEECCHHHHHHHCCEEEEEE T ss_conf 659245234999998724----9999998784002797799999999999999739889999399999998699999998 Q ss_pred E Q ss_conf 9 Q gi|255764514|r 504 K 504 (554) Q Consensus 504 K 504 (554) + T Consensus 204 ~ 204 (352) T PRK11144 204 Q 204 (352) T ss_pred C T ss_conf 9 No 364 >PRK10938 putative molybdenum transport ATP-binding protein ModF; Provisional Probab=97.71 E-value=0.00022 Score=47.90 Aligned_cols=40 Identities=33% Similarity=0.377 Sum_probs=33.1 Q ss_pred EEEEECC-------EEEEEEEEECCCC-EEEEECCCCCCHHHHHHHHH Q ss_conf 5999422-------7899998873898-18998899978889999999 Q gi|255764514|r 3 RLSIYNI-------VLIESLDIDFSAG-LSILSGDTGSGKSILLDALI 42 (554) Q Consensus 3 ~L~i~Nf-------~~i~~~~i~f~~G-l~vItGetGaGKS~ildAl~ 42 (554) -|.|+|+ .+++++++++.+| ..+|+||||||||+++.+|. T Consensus 3 ~L~i~nlt~~~g~~~~L~~vsl~i~~Ge~~~LvG~NGaGKSTL~k~l~ 50 (490) T PRK10938 3 SLQISQGTFRLSDTKTLQLPSLTLNAGDSWAFVGSNGSGKSALARALA 50 (490) T ss_pred EEEEEEEEEEECCEEEEEEEEEEECCCCEEEEECCCCCHHHHHHHHHH T ss_conf 299925999989988893159899899899999799977999999995 No 365 >PRK13637 cbiO cobalt transporter ATP-binding subunit; Provisional Probab=97.70 E-value=5.2e-05 Score=51.97 Aligned_cols=35 Identities=34% Similarity=0.569 Sum_probs=29.6 Q ss_pred EEEEEEEECCCC-EEEEECCCCCCHHHHHHHHHHHH Q ss_conf 899998873898-18998899978889999999871 Q gi|255764514|r 11 LIESLDIDFSAG-LSILSGDTGSGKSILLDALILVT 45 (554) Q Consensus 11 ~i~~~~i~f~~G-l~vItGetGaGKS~ildAl~~~l 45 (554) .++++++++.+| +.+|+|+||||||+++..|+-++ T Consensus 22 aL~~isl~i~~GE~v~iiG~nGsGKSTLl~~l~GLl 57 (287) T PRK13637 22 ALDNVNIEIEDGEFVALIGHTGSGKSTLIQHLNGLL 57 (287) T ss_pred EEECEEEEECCCCEEEEECCCCCHHHHHHHHHHCCC T ss_conf 753207698799899999999939999999997399 No 366 >cd03219 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine. MJ1267 is a branched-chain amino acid transporter with 29% similarity to both the LivF and LivG components of the E. coli branched-chain amino acid transporter. MJ1267 contains an insertion from residues 114 to 123 characteristic of LivG (Leucine-Isoleucine-Valine) homologs. The branched-chain amino acid transporter from E. coli comprises a heterodimer of ABCs (LivF and LivG), a heterodimer of six-helix TM domains (LivM and LivH), and one of two alternative soluble periplasmic substrate binding proteins (LivK or LivJ). Probab=97.70 E-value=9.2e-05 Score=50.35 Aligned_cols=39 Identities=21% Similarity=0.390 Sum_probs=32.4 Q ss_pred ECCEEEEEEEEECCCC-EEEEECCCCCCHHHHHHHHHHHH Q ss_conf 4227899998873898-18998899978889999999871 Q gi|255764514|r 7 YNIVLIESLDIDFSAG-LSILSGDTGSGKSILLDALILVT 45 (554) Q Consensus 7 ~Nf~~i~~~~i~f~~G-l~vItGetGaGKS~ildAl~~~l 45 (554) .++...++++++..+| +..|.||||||||+++.+|+-++ T Consensus 11 g~~~aL~~vsl~i~~Gei~gliG~nGaGKSTL~~~i~Gl~ 50 (236) T cd03219 11 GGLVALDDVSFSVRPGEIHGLIGPNGAGKTTLFNLISGFL 50 (236) T ss_pred CCEEEECCEEEEECCCCEEEEECCCCCCHHHHHHHHHCCC T ss_conf 9999872338998899899999899973999999996798 No 367 >cd03289 ABCC_CFTR2 The CFTR subfamily domain 2. The cystic fibrosis transmembrane regulator (CFTR), the product of the gene mutated in patients with cystic fibrosis, has adapted the ABC transporter structural motif to form a tightly regulated anion channel at the apical surface of many epithelia. Use of the term assembly of a functional ion channel implies the coming together of subunits or at least smaller not-yet functional components of the active whole. In fact, on the basis of current knowledge only the CFTR polypeptide itself is required to form an ATP- and protein kinase A-dependent low-conductance chloride channel of the type present in the apical membrane of many epithelial cells. CFTR displays the typical organization (IM-ABC)2 and carries a characteristic hydrophilic R-domain that separates IM1-ABC1 from IM2-ABC2. Probab=97.70 E-value=5.3e-05 Score=51.90 Aligned_cols=35 Identities=40% Similarity=0.583 Sum_probs=29.5 Q ss_pred EEEEEEEECCCC-EEEEECCCCCCHHHHHHHHHHHH Q ss_conf 899998873898-18998899978889999999871 Q gi|255764514|r 11 LIESLDIDFSAG-LSILSGDTGSGKSILLDALILVT 45 (554) Q Consensus 11 ~i~~~~i~f~~G-l~vItGetGaGKS~ildAl~~~l 45 (554) .++++++.+.+| +.+|+|+||||||+|+.+|.-++ T Consensus 19 vL~~isf~I~~Ge~vaIvG~sGsGKSTLl~lL~gl~ 54 (275) T cd03289 19 VLENISFSISPGQRVGLLGRTGSGKSTLLSAFLRLL 54 (275) T ss_pred CEECEEEEECCCCEEEEECCCCCCHHHHHHHHHHHC T ss_conf 242507998799999999999997999999996035 No 368 >cd03299 ABC_ModC_like Archeal protein closely related to ModC. ModC is an ABC-type transporter and the ATPase component of a molybdate transport system that also includes the periplasmic binding protein ModA and the membrane protein ModB. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins. Probab=97.70 E-value=5.2e-05 Score=51.99 Aligned_cols=38 Identities=26% Similarity=0.517 Sum_probs=30.8 Q ss_pred ECCEEEEEEEEECCCC-EEEEECCCCCCHHHHHHHHHHHH Q ss_conf 4227899998873898-18998899978889999999871 Q gi|255764514|r 7 YNIVLIESLDIDFSAG-LSILSGDTGSGKSILLDALILVT 45 (554) Q Consensus 7 ~Nf~~i~~~~i~f~~G-l~vItGetGaGKS~ildAl~~~l 45 (554) .+++ +++++++..+| +.+|.||||||||+++.+|.-++ T Consensus 11 g~~~-L~~vs~~v~~Ge~~~iiGpSGsGKSTLlr~i~Gl~ 49 (235) T cd03299 11 KEFK-LKNVSLEVERGDYFVILGPTGSGKSVLLETIAGFI 49 (235) T ss_pred CCCE-ECCCEEEECCCCEEEEECCCCCHHHHHHHHHHCCC T ss_conf 9949-90148798899899999999635999999997499 No 369 >cd03297 ABC_ModC_molybdenum_transporter ModC is an ABC-type transporter and the ATPase component of a molybdate transport system that also includes the periplasmic binding protein ModA and the membrane protein ModB. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins. Probab=97.69 E-value=9.5e-05 Score=50.24 Aligned_cols=41 Identities=24% Similarity=0.437 Sum_probs=30.3 Q ss_pred EEEEECCEEEEEEEEECCCCEEEEECCCCCCHHHHHHHHHHHH Q ss_conf 5999422789999887389818998899978889999999871 Q gi|255764514|r 3 RLSIYNIVLIESLDIDFSAGLSILSGDTGSGKSILLDALILVT 45 (554) Q Consensus 3 ~L~i~Nf~~i~~~~i~f~~Gl~vItGetGaGKS~ildAl~~~l 45 (554) +.+..||.+ +++++....+++|.||+|||||+++..|.-+. T Consensus 7 ~k~~g~f~l--~i~f~i~ge~~~iiGpSGsGKSTll~~i~GL~ 47 (214) T cd03297 7 EKRLPDFTL--KIDFDLNEEVTGIFGASGAGKSTLLRCIAGLE 47 (214) T ss_pred EEEECCEEE--EEEEECCCCEEEEECCCCCHHHHHHHHHHCCC T ss_conf 999899999--99986299799999999735999999998499 No 370 >cd03267 ABC_NatA_like Similar in sequence to NatA, this is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled to proton or K+ uptake. NatB possess six putative membrane spanning regions at its C-terminus. In B. subtilis, NatAB is inducible by agents such as ethanol and protonophores, which lower the protonmotive force across the membrane. The closest sequence similarity to NatA is exhibited by DrrA of the two-component daunomycin- and doxorubicin-efflux system. Hence, the functional NatAB is presumably assembled with two copies of the single ATP-binding protein and the single intergral membrane protein. Probab=97.69 E-value=5e-05 Score=52.11 Aligned_cols=38 Identities=18% Similarity=0.352 Sum_probs=31.7 Q ss_pred CCEEEEEEEEECCCC-EEEEECCCCCCHHHHHHHHHHHH Q ss_conf 227899998873898-18998899978889999999871 Q gi|255764514|r 8 NIVLIESLDIDFSAG-LSILSGDTGSGKSILLDALILVT 45 (554) Q Consensus 8 Nf~~i~~~~i~f~~G-l~vItGetGaGKS~ildAl~~~l 45 (554) ++...++++++..+| +.+|.||||||||+++..|+-++ T Consensus 33 ~~~al~~vsf~i~~Gei~gLlGpNGaGKSTllk~l~Gl~ 71 (236) T cd03267 33 EVEALKGISFTIEKGEIVGFIGPNGAGKTTTLKILSGLL 71 (236) T ss_pred CEEEECCCEEEECCCCEEEEECCCCCHHHHHHHHHHCCC T ss_conf 989866805788489599999999830999999996494 No 371 >TIGR03522 GldA_ABC_ATP gliding motility-associated ABC transporter ATP-binding subunit GldA. Members of this protein family are exclusive to the Bacteroidetes phylum (previously Cytophaga-Flavobacteria-Bacteroides). GldA is an ABC transporter ATP-binding protein (pfam00005) linked to a type of rapid surface gliding motility found in certain Bacteroidetes, such as Flavobacterium johnsoniae and Cytophaga hutchinsonii. Knockouts of GldA abolish the gliding phenotype. Gliding motility appears closely linked to chitin utilization in the model species Flavobacterium johnsoniae. Bacteroidetes with members of this protein family appear to have all of the genes associated with gliding motility. Probab=97.69 E-value=7.3e-05 Score=51.00 Aligned_cols=75 Identities=20% Similarity=0.217 Sum_probs=62.4 Q ss_pred HHCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCEEEEECHHHHHHHCCCEEEEEEE Q ss_conf 4062157999999999843668997699803446888799999999999973059399980837986501761799996 Q gi|255764514|r 427 LASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSKKIQLLAVTHAPQVAARADRHFLVYKT 505 (554) Q Consensus 427 iaSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~~~Qvi~ITH~pqvAa~a~~h~~v~K~ 505 (554) -+|||.+-|+++|..++ ..++.+|+||.=+|++-.....+-+.|+++++..-||++||.-.-|..--.|+.|-+. T Consensus 133 ~LS~G~kqrl~la~aL~----~~P~lliLDEPt~GLDp~~~~~~~~~l~~l~~~~TillssH~l~e~e~lcdri~ii~~ 207 (301) T TIGR03522 133 QLSKGYRQRVGLAQALI----HDPKVLILDEPTTGLDPNQLVEIRNVIKNIGKDKTIILSTHIMQEVEAICDRVIIINK 207 (301) T ss_pred HCCHHHHHHHHHHHHHC----CCCCEEEEECCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCHHHHHHHCCEEEEEEC T ss_conf 77998844599889870----7998999948866789899999999999875999999987858999986999999989 No 372 >COG4618 ArpD ABC-type protease/lipase transport system, ATPase and permease components [General function prediction only] Probab=97.69 E-value=0.00047 Score=45.67 Aligned_cols=93 Identities=24% Similarity=0.344 Sum_probs=66.6 Q ss_pred HCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHH-HHCCCEEEEECHHHHHHHCCCEEEEEEEE Q ss_conf 06215799999999984366899769980344688879999999999997-30593999808379865017617999962 Q gi|255764514|r 428 ASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQL-SKKIQLLAVTHAPQVAARADRHFLVYKTN 506 (554) Q Consensus 428 aSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~l-s~~~Qvi~ITH~pqvAa~a~~h~~v~K~~ 506 (554) +|||.+=||.||=.+ +...-++|+||-++|++..-=..+.+-+..+ ++..=+++|||-|-+.+..|+-+... T Consensus 473 LSgGQRQRIaLARAl----YG~P~lvVLDEPNsNLD~~GE~AL~~Ai~~~k~rG~~vvviaHRPs~L~~~Dkilvl~--- 545 (580) T COG4618 473 LSGGQRQRIALARAL----YGDPFLVVLDEPNSNLDSEGEAALAAAILAAKARGGTVVVIAHRPSALASVDKILVLQ--- 545 (580) T ss_pred CCCHHHHHHHHHHHH----CCCCCEEEECCCCCCCCHHHHHHHHHHHHHHHHCCCEEEEEECCHHHHHHCCEEEEEC--- T ss_conf 772378999999997----0897089955898776526799999999999976987999926777885155344223--- Q ss_pred CCCCCCEEEEEEEECCHHHHHHHHHHHHCCC Q ss_conf 1687525899999759889999999986688 Q gi|255764514|r 507 KPDDTQRIETYVAVLTPQERREEIARMLAGS 537 (554) Q Consensus 507 ~~~~~~~~~~~i~~l~~~~r~~Eiarml~g~ 537 (554) ++ + +. ....|-+-+|.++.+. T Consensus 546 -~G---~----~~--~FG~r~eVLa~~~~~~ 566 (580) T COG4618 546 -DG---R----IA--AFGPREEVLAKVLRPP 566 (580) T ss_pred -CC---H----HH--HCCCHHHHHHHHCCCC T ss_conf -88---4----77--4197789999852788 No 373 >cd03369 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-type transporter 1). NFT1 belongs to the MRP (mulrtidrug resisitance-associated protein) family of ABC transporters. Some of the MRP members have five additional transmembrane segments in their N-terminas, but the function of these additional membrane-spanning domains is not clear. The MRP was found in the multidrug-resisting lung cancer cell in which p-glycoprotein was not overexpressed. MRP exports glutathione by drug stimulation, as well as, certain substrates in conjugated forms with anions such as glutathione, glucuronate, and sulfate. Probab=97.69 E-value=6.6e-05 Score=51.31 Aligned_cols=35 Identities=31% Similarity=0.456 Sum_probs=29.9 Q ss_pred EEEEEEEECCCC-EEEEECCCCCCHHHHHHHHHHHH Q ss_conf 899998873898-18998899978889999999871 Q gi|255764514|r 11 LIESLDIDFSAG-LSILSGDTGSGKSILLDALILVT 45 (554) Q Consensus 11 ~i~~~~i~f~~G-l~vItGetGaGKS~ildAl~~~l 45 (554) .++++++.+.+| +.+|+|+||||||+++.+|.=.+ T Consensus 23 iL~~isl~i~~Ge~v~ivG~sGsGKSTLl~ll~g~~ 58 (207) T cd03369 23 VLKNVSFKVKAGEKIGIVGRTGAGKSTLILALFRFL 58 (207) T ss_pred CEEEEEEEECCCCEEEEECCCCCCHHHHHHHHHHHC T ss_conf 240258898699999999999987999999999872 No 374 >cd03262 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-binding components of the bacterial periplasmic histidine and glutamine permeases, repectively. Histidine permease is a multisubunit complex containing the HisQ and HisM integral membrane subunits and two copies of HisP. HisP has properties intermediate between those of integral and peripheral membrane proteins and is accessible from both sides of the membrane, presumably by its interaction with HisQ and HisM. The two HisP subunits form a homodimer within the complex. The domain structure of the amino acid uptake systems is typical for prokaryote extracellular solute binding protein-dependent uptake systems. All of the amino acid uptake systems also have at least one, and in a few cases, two extracellular solute binding proteins located in the periplasm of Gram-negative bacteria, or attached to the cell membrane of Gram-positive bacteria. The best-studied member of the PAAT (polar amino acid transport) family is the HisJQM Probab=97.68 E-value=5.8e-05 Score=51.66 Aligned_cols=38 Identities=29% Similarity=0.619 Sum_probs=31.8 Q ss_pred CCEEEEEEEEECCCC-EEEEECCCCCCHHHHHHHHHHHH Q ss_conf 227899998873898-18998899978889999999871 Q gi|255764514|r 8 NIVLIESLDIDFSAG-LSILSGDTGSGKSILLDALILVT 45 (554) Q Consensus 8 Nf~~i~~~~i~f~~G-l~vItGetGaGKS~ildAl~~~l 45 (554) +...++++++++.+| +.+|+||+|||||++|..|.-+. T Consensus 12 ~~~vL~~vsl~i~~Ge~~~ivGpSGsGKSTLL~~i~gL~ 50 (213) T cd03262 12 DFHVLKGIDLTVKKGEVVVIIGPSGSGKSTLLRCINLLE 50 (213) T ss_pred CEEEECCEEEEECCCCEEEEECCCCCHHHHHHHHHHCCC T ss_conf 998886707598899899999999844999999998199 No 375 >PRK11124 artP arginine transporter ATP-binding subunit; Provisional Probab=97.68 E-value=0.00012 Score=49.59 Aligned_cols=36 Identities=33% Similarity=0.487 Sum_probs=30.1 Q ss_pred CEEEEEEEEECCCC-EEEEECCCCCCHHHHHHHHHHH Q ss_conf 27899998873898-1899889997888999999987 Q gi|255764514|r 9 IVLIESLDIDFSAG-LSILSGDTGSGKSILLDALILV 44 (554) Q Consensus 9 f~~i~~~~i~f~~G-l~vItGetGaGKS~ildAl~~~ 44 (554) ...++++++++.+| +.+|.||||||||+++..|+-+ T Consensus 15 ~~aL~dvsl~i~~Ge~~~iiG~nGaGKSTLl~~l~gl 51 (242) T PRK11124 15 HQALFDITLDCPQGETLVLLGPSGAGKSSLLRVLNLL 51 (242) T ss_pred EEEEEEEEEEECCCCEEEEECCCCCCHHHHHHHHHCC T ss_conf 9989420778879989999999997199999999658 No 376 >COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Probab=97.67 E-value=5.1e-05 Score=52.02 Aligned_cols=37 Identities=30% Similarity=0.539 Sum_probs=30.7 Q ss_pred CEEEEEEEEECCCC-EEEEECCCCCCHHHHHHHHHHHH Q ss_conf 27899998873898-18998899978889999999871 Q gi|255764514|r 9 IVLIESLDIDFSAG-LSILSGDTGSGKSILLDALILVT 45 (554) Q Consensus 9 f~~i~~~~i~f~~G-l~vItGetGaGKS~ildAl~~~l 45 (554) +...+.+++++.+| |.+|+||+|||||++|.-|..+. T Consensus 18 ~~~L~~v~l~i~~Ge~vaI~GpSGSGKSTLLniig~ld 55 (226) T COG1136 18 VEALKDVNLEIEAGEFVAIVGPSGSGKSTLLNLLGGLD 55 (226) T ss_pred EEECCCCEEEECCCCEEEEECCCCCCHHHHHHHHHCCC T ss_conf 67524625887499899998999998999999996466 No 377 >PRK00349 uvrA excinuclease ABC subunit A; Reviewed Probab=97.67 E-value=0.00031 Score=46.82 Aligned_cols=74 Identities=22% Similarity=0.236 Sum_probs=57.5 Q ss_pred HHCCHHHHHHHHHHHHHHCCCCC-CCEEEEECCCCCCCHHHHHHHHHHHHHHHH-CCCEEEEECHHHHHHHCCCEEEE Q ss_conf 40621579999999998436689-976998034468887999999999999730-59399980837986501761799 Q gi|255764514|r 427 LASGGELSRFLLALKIVLVDQGS-IPTLVFDEVDSGIGGAVADAIGYRLKQLSK-KIQLLAVTHAPQVAARADRHFLV 502 (554) Q Consensus 427 iaSGGE~Sr~~LAl~~~~~~~~~-~p~~ifDEiDagi~G~~a~~v~~~l~~ls~-~~Qvi~ITH~pqvAa~a~~h~~v 502 (554) .+||||.=|+-||-.+. +... ...|||||--+|+--.-..++-..|.+|-. .+=||||-|-+.|.+.||.=+=+ T Consensus 830 TLSGGEaQRlKLa~~L~--~~~~~~tlyilDEPTtGLH~~Di~~Ll~~l~~Lv~~G~tviviEHnldvi~~aDwiIdl 905 (944) T PRK00349 830 TLSGGEAQRVKLAKELS--KRSTGKTLYILDEPTTGLHFEDIRKLLEVLHRLVDKGNTVVVIEHNLDVIKTADWIIDL 905 (944) T ss_pred CCCHHHHHHHHHHHHHC--CCCCCCEEEEECCCCCCCCHHHHHHHHHHHHHHHHCCCEEEEEECCHHHHHHCCEEEEC T ss_conf 86558999999999974--77889879997588767898999999999999996899799994788899759999976 No 378 >cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos). The Carb_Monos family is involved in the uptake of monosaccharides, such as pentoses (such as xylose, arabinose, and ribose) and hexoses (such as xylose, arabinose, and ribose), that cannot be broken down to simple sugars by hydrolysis. Pentoses include xylose, arabinose, and ribose. Important hexoses include glucose, galactose, and fructose. In members of the Carb_monos family, the single hydrophobic gene product forms a homodimer while the ABC protein represents a fusion of two nucleotide-binding domains. However, it is assumed that two copies of the ABC domains are present in the assembled transporter. Probab=97.67 E-value=0.0001 Score=49.97 Aligned_cols=39 Identities=23% Similarity=0.427 Sum_probs=32.2 Q ss_pred ECCEEEEEEEEECCCC-EEEEECCCCCCHHHHHHHHHHHH Q ss_conf 4227899998873898-18998899978889999999871 Q gi|255764514|r 7 YNIVLIESLDIDFSAG-LSILSGDTGSGKSILLDALILVT 45 (554) Q Consensus 7 ~Nf~~i~~~~i~f~~G-l~vItGetGaGKS~ildAl~~~l 45 (554) -+...++++++++.+| +.+|.||||||||+++..|.-++ T Consensus 11 g~~~aL~~vsl~i~~Gei~~lvG~nGaGKSTl~~~i~Gl~ 50 (163) T cd03216 11 GGVKALDGVSLSVRRGEVHALLGENGAGKSTLMKILSGLY 50 (163) T ss_pred CCEEEECCEEEEECCCCEEEEECCCCCCHHHHHHHHHCCC T ss_conf 9999885548898799899999889989999999995776 No 379 >PRK10261 glutathione transporter ATP-binding protein; Provisional Probab=97.67 E-value=0.00037 Score=46.38 Aligned_cols=73 Identities=25% Similarity=0.325 Sum_probs=58.3 Q ss_pred HCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHC--CCEEEEEC-HHHHHHHCCCEEEEEE Q ss_conf 06215799999999984366899769980344688879999999999997305--93999808-3798650176179999 Q gi|255764514|r 428 ASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSKK--IQLLAVTH-APQVAARADRHFLVYK 504 (554) Q Consensus 428 aSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~~--~Qvi~ITH-~pqvAa~a~~h~~v~K 504 (554) +|||+.=|+++|-.++. ...++|+||.=+|++=.+-..|-++|++|.+. .=+|.||| ++-|+..+|+=.+.+. T Consensus 464 LSGGqrQRv~IAraL~~----~P~lLI~DEPTs~LDv~~qa~il~Ll~~L~~~~g~til~IsHDl~~v~~~adrv~Vm~~ 539 (623) T PRK10261 464 FSGGQRQRICIARALAL----NPKVIIADEAVSALDVSIRGQIINLLLDLQRDFGIAYLFISHDMAVVERISHRVAVMYL 539 (623) T ss_pred CCHHHHHHHHHHHHHHH----CCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHHCCEEEEECCCHHHHHHHCCEEEEEEC T ss_conf 89999999999999996----99999996886667999999999999999997298999986899999986999999989 No 380 >cd03261 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins. Probab=97.67 E-value=9.9e-05 Score=50.15 Aligned_cols=38 Identities=29% Similarity=0.513 Sum_probs=31.9 Q ss_pred ECCEEEEEEEEECCCC-EEEEECCCCCCHHHHHHHHHHH Q ss_conf 4227899998873898-1899889997888999999987 Q gi|255764514|r 7 YNIVLIESLDIDFSAG-LSILSGDTGSGKSILLDALILV 44 (554) Q Consensus 7 ~Nf~~i~~~~i~f~~G-l~vItGetGaGKS~ildAl~~~ 44 (554) .+...++++++++.+| +.+|.||||||||+++.+|.-+ T Consensus 11 g~~~~L~~isl~i~~Ge~~~iiG~SGsGKSTll~~i~gL 49 (235) T cd03261 11 GGRTVLKGVDLDVRRGEILAIIGPSGSGKSTLLRLIVGL 49 (235) T ss_pred CCEEEECCEEEEECCCCEEEEECCCCCHHHHHHHHHHCC T ss_conf 999888260648879989999999997299999999759 No 381 >cd03291 ABCC_CFTR1 The CFTR subfamily domain 1. The cystic fibrosis transmembrane regulator (CFTR), the product of the gene mutated in patients with cystic fibrosis, has adapted the ABC transporter structural motif to form a tightly regulated anion channel at the apical surface of many epithelia. Use of the term assembly of a functional ion channel implies the coming together of subunits, or at least smaller not-yet functional components of the active whole. In fact, on the basis of current knowledge only the CFTR polypeptide itself is required to form an ATP- and protein kinase A-dependent low-conductance chloride channel of the type present in the apical membrane of many epithelial cells. CFTR displays the typical organization (IM-ABC)2 and carries a characteristic hydrophilic R-domain that separates IM1-ABC1 from IM2-ABC2. Probab=97.67 E-value=6.4e-05 Score=51.37 Aligned_cols=32 Identities=28% Similarity=0.666 Sum_probs=28.5 Q ss_pred EEEEEEEECCCC-EEEEECCCCCCHHHHHHHHH Q ss_conf 899998873898-18998899978889999999 Q gi|255764514|r 11 LIESLDIDFSAG-LSILSGDTGSGKSILLDALI 42 (554) Q Consensus 11 ~i~~~~i~f~~G-l~vItGetGaGKS~ildAl~ 42 (554) ..+++++.+.+| +.+|+|+||||||+|+..|. T Consensus 52 VLk~Isf~I~~Ge~vaIVG~sGSGKSTLl~lL~ 84 (282) T cd03291 52 VLKNINLKIEKGEMLAITGSTGSGKTSLLMLIL 84 (282) T ss_pred EEECEEEEECCCCEEEEECCCCCHHHHHHHHHH T ss_conf 141648998499999999999981999999995 No 382 >cd03252 ABCC_Hemolysin The ABC-transporter hemolysin B is a central component of the secretion machinery that translocates the toxin, hemolysin A, in a Sec-independent fashion across both membranes of E. coli. The hemolysin A (HlyA) transport machinery is composed of the ATP-binding cassette (ABC) transporter HlyB located in the inner membrane, hemolysin D (HlyD), also anchored in the inner membrane, and TolC, which resides in the outer membrane. HlyD apparently forms a continuous channel that bridges the entire periplasm, interacting with TolC and HlyB. This arrangement prevents the appearance of periplasmic intermediates of HlyA during substrate transport. Little is known about the molecular details of HlyA transport, but it is evident that ATP-hydrolysis by the ABC-transporter HlyB is a necessary source of energy. Probab=97.66 E-value=5.8e-05 Score=51.65 Aligned_cols=33 Identities=24% Similarity=0.504 Sum_probs=28.2 Q ss_pred EEEEEEEECCCC-EEEEECCCCCCHHHHHHHHHH Q ss_conf 899998873898-189988999788899999998 Q gi|255764514|r 11 LIESLDIDFSAG-LSILSGDTGSGKSILLDALIL 43 (554) Q Consensus 11 ~i~~~~i~f~~G-l~vItGetGaGKS~ildAl~~ 43 (554) .++++++++.+| +++|+|+||||||+|+..|.= T Consensus 17 ~L~~is~~i~~G~~vaivG~sGsGKSTll~ll~g 50 (237) T cd03252 17 ILDNISLRIKPGEVVGIVGRSGSGKSTLTKLIQR 50 (237) T ss_pred CEECCEEEECCCCEEEEECCCCCHHHHHHHHHHC T ss_conf 2515089987999999999999859999999967 No 383 >PRK10762 D-ribose transporter ATP binding protein; Provisional Probab=97.66 E-value=0.00031 Score=46.85 Aligned_cols=37 Identities=24% Similarity=0.463 Sum_probs=31.1 Q ss_pred CEEEEEEEEECCCC-EEEEECCCCCCHHHHHHHHHHHH Q ss_conf 27899998873898-18998899978889999999871 Q gi|255764514|r 9 IVLIESLDIDFSAG-LSILSGDTGSGKSILLDALILVT 45 (554) Q Consensus 9 f~~i~~~~i~f~~G-l~vItGetGaGKS~ildAl~~~l 45 (554) ....+++++++.+| +.+|+||||||||+++.+|+-++ T Consensus 17 ~~aL~~vsl~i~~Gei~~liG~nGaGKSTL~~~l~G~~ 54 (501) T PRK10762 17 VKALSGAALNVYPGRVMALVGENGAGKSTLMKVLTGIY 54 (501) T ss_pred EEEECCEEEEECCCCEEEEECCCCCHHHHHHHHHHCCC T ss_conf 99885547899899699998999982999999995799 No 384 >PRK13537 lipooligosaccharide transporter ATP-binding subunit; Provisional Probab=97.66 E-value=8.8e-05 Score=50.46 Aligned_cols=39 Identities=26% Similarity=0.395 Sum_probs=31.7 Q ss_pred ECCEEEEEEEEECCCC-EEEEECCCCCCHHHHHHHHHHHH Q ss_conf 4227899998873898-18998899978889999999871 Q gi|255764514|r 7 YNIVLIESLDIDFSAG-LSILSGDTGSGKSILLDALILVT 45 (554) Q Consensus 7 ~Nf~~i~~~~i~f~~G-l~vItGetGaGKS~ildAl~~~l 45 (554) .+...+++++++..+| +..|.||||||||+++..|.-++ T Consensus 16 g~~~al~~vs~~V~~Gei~gllGpNGAGKTTli~~l~Gl~ 55 (304) T PRK13537 16 GDKLVVDGLSFHVQPGECFGLLGPNGAGKTTTLKMLLGLT 55 (304) T ss_pred CCEEEECCEEEEECCCCEEEEECCCCCCHHHHHHHHHCCC T ss_conf 9999983717788699599999998972999999997795 No 385 >cd03265 ABC_DrrA DrrA is the ATP-binding protein component of a bacterial exporter complex that confers resistance to the antibiotics daunorubicin and doxorubicin. In addition to DrrA, the complex includes an integral membrane protein called DrrB. DrrA belongs to the ABC family of transporters and shares sequence and functional similarities with a protein found in cancer cells called P-glycoprotein. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region in addition to the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins. Probab=97.65 E-value=7.9e-05 Score=50.77 Aligned_cols=39 Identities=18% Similarity=0.301 Sum_probs=31.9 Q ss_pred ECCEEEEEEEEECCCC-EEEEECCCCCCHHHHHHHHHHHH Q ss_conf 4227899998873898-18998899978889999999871 Q gi|255764514|r 7 YNIVLIESLDIDFSAG-LSILSGDTGSGKSILLDALILVT 45 (554) Q Consensus 7 ~Nf~~i~~~~i~f~~G-l~vItGetGaGKS~ildAl~~~l 45 (554) .++..+++++++..+| +.++.||||||||+++.-|.-++ T Consensus 11 ~~~~al~~is~~v~~Gei~gllGpNGAGKSTll~~i~Gl~ 50 (220) T cd03265 11 GDFEAVRGVSFRVRRGEIFGLLGPNGAGKTTTIKMLTTLL 50 (220) T ss_pred CCEEEECCCEEEECCCCEEEEECCCCCHHHHHHHHHHCCC T ss_conf 9999985826798898399999999871999999997697 No 386 >PRK11000 maltose/maltodextrin transporter ATP-binding protein; Provisional Probab=97.65 E-value=6.7e-05 Score=51.27 Aligned_cols=36 Identities=28% Similarity=0.612 Sum_probs=30.0 Q ss_pred CEEEEEEEEECCCC-EEEEECCCCCCHHHHHHHHHHH Q ss_conf 27899998873898-1899889997888999999987 Q gi|255764514|r 9 IVLIESLDIDFSAG-LSILSGDTGSGKSILLDALILV 44 (554) Q Consensus 9 f~~i~~~~i~f~~G-l~vItGetGaGKS~ildAl~~~ 44 (554) +..+++++++..+| +.+|.||||||||+++..|.-+ T Consensus 16 ~~al~~vsl~i~~Ge~~~llGpsG~GKSTllr~i~Gl 52 (369) T PRK11000 16 VVISKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGL 52 (369) T ss_pred EEEECCCEEEECCCCEEEEECCCCCHHHHHHHHHHCC T ss_conf 9998643889879989999999973699999999779 No 387 >cd03288 ABCC_SUR2 The SUR domain 2. The sulfonylurea receptor SUR is an ATP binding cassette (ABC) protein of the ABCC/MRP family. Unlike other ABC proteins, it has no intrinsic transport function, neither active nor passive, but associates with the potassium channel proteins Kir6.1 or Kir6.2 to form the ATP-sensitive potassium (K(ATP)) channel. Within the channel complex, SUR serves as a regulatory subunit that fine-tunes the gating of Kir6.x in response to alterations in cellular metabolism. It constitutes a major pharmaceutical target as it binds numerous drugs, K(ATP) channel openers and blockers, capable of up- or down-regulating channel activity. Probab=97.64 E-value=6.9e-05 Score=51.17 Aligned_cols=34 Identities=29% Similarity=0.375 Sum_probs=28.5 Q ss_pred EEEEEEEECCCC-EEEEECCCCCCHHHHHHHHHHH Q ss_conf 899998873898-1899889997888999999987 Q gi|255764514|r 11 LIESLDIDFSAG-LSILSGDTGSGKSILLDALILV 44 (554) Q Consensus 11 ~i~~~~i~f~~G-l~vItGetGaGKS~ildAl~~~ 44 (554) .++++++.+.+| +.+|+|+||||||+++.+|.=+ T Consensus 36 vL~~inl~I~~Ge~vaIvG~sGsGKSTL~~ll~gl 70 (257) T cd03288 36 VLKHVKAYIKPGQKVGICGRTGSGKSSLSLAFFRM 70 (257) T ss_pred CEECEEEEECCCCEEEEECCCCCCHHHHHHHHHHC T ss_conf 31053899879999999999998199999999605 No 388 >cd03298 ABC_ThiQ_thiamine_transporter ABC-type thiamine tranport system; part of the binding-protein-dependent transport system tbpA-thiPQ for thiamine and TPP. Probably responsible for the translocation of thiamine across the membrane. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins. Probab=97.64 E-value=6.6e-05 Score=51.30 Aligned_cols=32 Identities=34% Similarity=0.660 Sum_probs=26.5 Q ss_pred EEEEECCCC-EEEEECCCCCCHHHHHHHHHHHH Q ss_conf 998873898-18998899978889999999871 Q gi|255764514|r 14 SLDIDFSAG-LSILSGDTGSGKSILLDALILVT 45 (554) Q Consensus 14 ~~~i~f~~G-l~vItGetGaGKS~ildAl~~~l 45 (554) ++++++.+| +++|.||||||||+++..|+-++ T Consensus 16 ~i~l~i~~Ge~~~ilGpSGsGKSTLl~li~Gl~ 48 (211) T cd03298 16 HFDLTFAQGEITAIVGPSGSGKSTLLNLIAGFE 48 (211) T ss_pred EEEEEECCCCEEEEECCCCCHHHHHHHHHHCCC T ss_conf 278898899899999999955999999997699 No 389 >COG3638 ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Probab=97.64 E-value=0.0001 Score=50.08 Aligned_cols=35 Identities=26% Similarity=0.544 Sum_probs=30.5 Q ss_pred EEEEEEEECCCC-EEEEECCCCCCHHHHHHHHHHHH Q ss_conf 899998873898-18998899978889999999871 Q gi|255764514|r 11 LIESLDIDFSAG-LSILSGDTGSGKSILLDALILVT 45 (554) Q Consensus 11 ~i~~~~i~f~~G-l~vItGetGaGKS~ildAl~~~l 45 (554) .++++.+++.+| |.+|+|++|||||+||.+|..+. T Consensus 19 aL~~Vnl~I~~GE~VaiIG~SGaGKSTLLR~lngl~ 54 (258) T COG3638 19 ALKDVNLEINQGEMVAIIGPSGAGKSTLLRSLNGLV 54 (258) T ss_pred EEEEEEEEECCCCEEEEECCCCCCHHHHHHHHHCCC T ss_conf 663576775798689998788886899999986665 No 390 >PRK11248 tauB taurine transporter ATP-binding subunit; Provisional Probab=97.64 E-value=0.00067 Score=44.68 Aligned_cols=38 Identities=24% Similarity=0.493 Sum_probs=31.9 Q ss_pred CCEEEEEEEEECCCC-EEEEECCCCCCHHHHHHHHHHHH Q ss_conf 227899998873898-18998899978889999999871 Q gi|255764514|r 8 NIVLIESLDIDFSAG-LSILSGDTGSGKSILLDALILVT 45 (554) Q Consensus 8 Nf~~i~~~~i~f~~G-l~vItGetGaGKS~ildAl~~~l 45 (554) +...++++++++.+| +.+|.||||||||+++..|.-++ T Consensus 13 ~~~~L~dvsl~i~~Ge~~~lvGpnGaGKSTLl~~i~Gl~ 51 (255) T PRK11248 13 GKPALEDINLTLESGELLVVLGPSGCGKTTLLNLIAGFV 51 (255) T ss_pred CEEEEECEEEEECCCCEEEEECCCCCHHHHHHHHHHCCC T ss_conf 998881317798699899999999846999999997599 No 391 >PRK09452 potA putrescine/spermidine ABC transporter ATPase protein; Reviewed Probab=97.64 E-value=0.00012 Score=49.66 Aligned_cols=37 Identities=27% Similarity=0.460 Sum_probs=30.7 Q ss_pred CCEEEEEEEEECCCC-EEEEECCCCCCHHHHHHHHHHH Q ss_conf 227899998873898-1899889997888999999987 Q gi|255764514|r 8 NIVLIESLDIDFSAG-LSILSGDTGSGKSILLDALILV 44 (554) Q Consensus 8 Nf~~i~~~~i~f~~G-l~vItGetGaGKS~ildAl~~~ 44 (554) +...++++++++.+| |.+|.||||||||+++..|.-+ T Consensus 29 ~~~aL~~vsl~I~~GE~~~llGpSGsGKSTLlr~iaGl 66 (378) T PRK09452 29 GKEVISNLDLTINNGEFLTLLGPSGCGKTTVLRLIAGF 66 (378) T ss_pred CEEEEECCEEEECCCCEEEEECCCCCHHHHHHHHHHCC T ss_conf 99999362779999989999989997699999999769 No 392 >cd03220 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transporter subfamily is involved in extracellular polysaccharide export. Among the variety of membrane-linked or extracellular polysaccharides excreted by bacteria, only capsular polysaccharides, lipopolysaccharides, and teichoic acids have been shown to be exported by ABC transporters. A typical system is made of a conserved integral membrane and an ABC. In addition to these proteins, capsular polysaccharide exporter systems require two 'accessory' proteins to perform their function: a periplasmic (E.coli) or a lipid-anchored outer membrane protein called OMA (Neisseria meningitidis and Haemophilus influenzae) and a cytoplasmic membrane protein MPA2. Probab=97.64 E-value=7.6e-05 Score=50.89 Aligned_cols=38 Identities=26% Similarity=0.363 Sum_probs=32.0 Q ss_pred CCEEEEEEEEECCCC-EEEEECCCCCCHHHHHHHHHHHH Q ss_conf 227899998873898-18998899978889999999871 Q gi|255764514|r 8 NIVLIESLDIDFSAG-LSILSGDTGSGKSILLDALILVT 45 (554) Q Consensus 8 Nf~~i~~~~i~f~~G-l~vItGetGaGKS~ildAl~~~l 45 (554) +|.-.+++++++.+| +.+|.||||||||+++..|+-++ T Consensus 34 ~~~AL~~isf~i~~GeivgilG~NGaGKSTLl~~i~Gl~ 72 (224) T cd03220 34 EFWALKDVSFEVPRGERIGLIGRNGAGKSTLLRLLAGIY 72 (224) T ss_pred CEEEECCEEEEECCCCEEEEECCCCCHHHHHHHHHHCCC T ss_conf 969876707898389899999799981999999997587 No 393 >PRK11022 dppD dipeptide transporter ATP-binding subunit; Provisional Probab=97.63 E-value=0.00052 Score=45.41 Aligned_cols=72 Identities=28% Similarity=0.385 Sum_probs=55.5 Q ss_pred HCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHC--CCEEEEECHHH-HHHHCCCEEEEE Q ss_conf 06215799999999984366899769980344688879999999999997305--93999808379-865017617999 Q gi|255764514|r 428 ASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSKK--IQLLAVTHAPQ-VAARADRHFLVY 503 (554) Q Consensus 428 aSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~~--~Qvi~ITH~pq-vAa~a~~h~~v~ 503 (554) +|||++=|+++|..++. ....+|+||.=+|++-.+...|-++|++|.+. .=+|.|||=-. |+..+|+=.+.+ T Consensus 154 LSGGq~QRV~IArAL~~----~P~lLIaDEPTsaLD~~~q~~Il~ll~~l~~~~g~til~ITHDl~~v~~~aDri~VMy 228 (327) T PRK11022 154 LSGGMSQRVMIAMAIAC----RPKLLIADEPTTALDVTIQAQIIELLLELQQKENMALVLITHDLALVAEAAHKIIVMY 228 (327) T ss_pred CCHHHHHHHHHHHHHHH----CCCEEEECCCCCCCCHHHHHHHHHHHHHHHHHHCCCEEEEECCHHHHHHHCCEEEEEE T ss_conf 69999999999999970----9999998388765799999999999999999719948999288999998699899998 No 394 >PRK09473 oppD oligopeptide transporter ATP-binding component; Provisional Probab=97.63 E-value=0.00058 Score=45.06 Aligned_cols=35 Identities=31% Similarity=0.414 Sum_probs=29.7 Q ss_pred EEEEEEEECCCC-EEEEECCCCCCHHHHHHHHHHHH Q ss_conf 899998873898-18998899978889999999871 Q gi|255764514|r 11 LIESLDIDFSAG-LSILSGDTGSGKSILLDALILVT 45 (554) Q Consensus 11 ~i~~~~i~f~~G-l~vItGetGaGKS~ildAl~~~l 45 (554) .++++++++.+| +..|+||||||||+++.+|.-++ T Consensus 31 av~~Vsf~i~~GEilgivGeSGsGKSTl~~~i~gll 66 (330) T PRK09473 31 AVNDLNFSLRAGETLGIVGESGSGKSQTAFALMGLL 66 (330) T ss_pred EEECCEEEECCCCEEEEECCCCCHHHHHHHHHHCCC T ss_conf 866747688899899998689877999999997688 No 395 >cd03270 ABC_UvrA_I The excision repair protein UvrA domain I; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion. Recognition and cleavage of the damaged DNA is a multistep ATP-dependent reaction that requires the UvrA, UvrB, and UvrC proteins. Both UvrA and UvrB are ATPases, with UvrA having two ATP binding sites, which have the characteristic signature of the family of ABC proteins, and UvrB having one ATP binding site that is structurally related to that of helicases. Probab=97.62 E-value=5.6e-05 Score=51.79 Aligned_cols=28 Identities=36% Similarity=0.653 Sum_probs=24.6 Q ss_pred EEEEEEEECCCC-EEEEECCCCCCHHHHH Q ss_conf 899998873898-1899889997888999 Q gi|255764514|r 11 LIESLDIDFSAG-LSILSGDTGSGKSILL 38 (554) Q Consensus 11 ~i~~~~i~f~~G-l~vItGetGaGKS~il 38 (554) ..+++++++.+| +++|+||||||||+|+ T Consensus 10 ~L~~Vsl~i~~Ge~~aIvG~nGsGKSTL~ 38 (226) T cd03270 10 NLKNVDVDIPRNKLVVITGVSGSGKSSLA 38 (226) T ss_pred CCCCEEEEECCCCEEEEECCCCCHHHHHH T ss_conf 65674899859989999878996098983 No 396 >PRK13633 cobalt transporter ATP-binding subunit; Provisional Probab=97.62 E-value=7.6e-05 Score=50.90 Aligned_cols=35 Identities=20% Similarity=0.503 Sum_probs=29.8 Q ss_pred EEEEEEEECCCC-EEEEECCCCCCHHHHHHHHHHHH Q ss_conf 899998873898-18998899978889999999871 Q gi|255764514|r 11 LIESLDIDFSAG-LSILSGDTGSGKSILLDALILVT 45 (554) Q Consensus 11 ~i~~~~i~f~~G-l~vItGetGaGKS~ildAl~~~l 45 (554) .++++++++.+| +.+|+|+||||||+++..|+-++ T Consensus 26 al~~Isl~i~~GE~v~iiG~nGsGKSTL~r~l~gl~ 61 (281) T PRK13633 26 ALDDVNLEVKKGEFLVILGHNGSGKSTIAKHMNALL 61 (281) T ss_pred EEECEEEEECCCCEEEEECCCCCHHHHHHHHHHCCC T ss_conf 673407688799899999999984999999997588 No 397 >PRK13537 lipooligosaccharide transporter ATP-binding subunit; Provisional Probab=97.62 E-value=0.00064 Score=44.78 Aligned_cols=73 Identities=30% Similarity=0.345 Sum_probs=59.7 Q ss_pred HHCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHH-CCCEEEEECHHHHHHH-CCCEEEEE Q ss_conf 40621579999999998436689976998034468887999999999999730-5939998083798650-17617999 Q gi|255764514|r 427 LASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSK-KIQLLAVTHAPQVAAR-ADRHFLVY 503 (554) Q Consensus 427 iaSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~-~~Qvi~ITH~pqvAa~-a~~h~~v~ 503 (554) -+|||.+-|+++|..++ ..++.++|||.=+|++-.....+-++|+++.+ ..-||++||.-.-|-. +|+=..+. T Consensus 136 ~lSgG~kqrl~ia~al~----~~P~lliLDEPT~GLDp~~r~~i~~~i~~l~~~G~TillttH~l~E~e~lcDrv~ii~ 210 (304) T PRK13537 136 ELSGGMKRRLTLARALV----NDPDVLVLDEPTTGLDPQARHLMWERLRSLLARGKTILLTTHFMEEAERLCDRLCVIE 210 (304) T ss_pred HCCHHHHHHHHHHHHHH----CCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCEEEEECCCHHHHHHHCCEEEEEE T ss_conf 79999999999999983----7999999938866789999999999999999689999998884899998699999998 No 398 >cd03269 ABC_putative_ATPase This subfamily is involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity. In eubacteria and archaea, the typical organization consists of one ABC and one or two IMs. Eukaryote systems of the ABCA subfamily display ABC domains strongly similar to this family. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region in addition to the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins. Probab=97.62 E-value=0.00076 Score=44.29 Aligned_cols=40 Identities=15% Similarity=0.359 Sum_probs=33.2 Q ss_pred EECCEEEEEEEEECCCC-EEEEECCCCCCHHHHHHHHHHHH Q ss_conf 94227899998873898-18998899978889999999871 Q gi|255764514|r 6 IYNIVLIESLDIDFSAG-LSILSGDTGSGKSILLDALILVT 45 (554) Q Consensus 6 i~Nf~~i~~~~i~f~~G-l~vItGetGaGKS~ildAl~~~l 45 (554) ..+...++++++++.+| ++.|.||||||||+++..|+=++ T Consensus 10 yg~~~al~~vs~~v~~Gei~gllG~NGaGKTTll~~i~Gl~ 50 (210) T cd03269 10 FGRVTALDDISFSVEKGEIFGLLGPNGAGKTTTIRMILGII 50 (210) T ss_pred ECCEEEECCEEEEECCCCEEEEECCCCCCHHHHHHHHHCCC T ss_conf 89999975426788799599999899984999999996002 No 399 >cd03295 ABC_OpuCA_Osmoprotection OpuCA is a the ATP binding component of a bacterial solute transporter that serves a protective role to cells growing in a hyperosmolar environment. ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition, to the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins. Probab=97.61 E-value=0.00011 Score=49.88 Aligned_cols=37 Identities=22% Similarity=0.472 Sum_probs=31.1 Q ss_pred CEEEEEEEEECCCC-EEEEECCCCCCHHHHHHHHHHHH Q ss_conf 27899998873898-18998899978889999999871 Q gi|255764514|r 9 IVLIESLDIDFSAG-LSILSGDTGSGKSILLDALILVT 45 (554) Q Consensus 9 f~~i~~~~i~f~~G-l~vItGetGaGKS~ildAl~~~l 45 (554) ...+++++++..+| +.+|.||||||||+++..|.-++ T Consensus 14 ~~al~~vsl~i~~Ge~~~ilGpSG~GKSTllr~i~gl~ 51 (242) T cd03295 14 KKAVNNLNLEIAKGEFLVLIGPSGSGKTTTMKMINRLI 51 (242) T ss_pred CEEEEEEEEEECCCCEEEEECCCCCHHHHHHHHHHCCC T ss_conf 88983027688699899999999956999999997599 No 400 >PRK10535 macrolide transporter ATP-binding /permease protein; Provisional Probab=97.61 E-value=0.00011 Score=49.90 Aligned_cols=13 Identities=23% Similarity=0.061 Sum_probs=8.9 Q ss_pred CEEEEECCEEEEC Q ss_conf 7799999988410 Q gi|255764514|r 101 RTKAYVNDQVVSV 113 (554) Q Consensus 101 kS~~~INg~~v~~ 113 (554) ..+++++|+.+.. T Consensus 62 ~G~v~~~G~~~~~ 74 (648) T PRK10535 62 SGTYRVAGQDVAT 74 (648) T ss_pred CEEEEECCEECCC T ss_conf 6699999999885 No 401 >cd03229 ABC_Class3 This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins. Probab=97.61 E-value=0.00011 Score=49.93 Aligned_cols=39 Identities=28% Similarity=0.480 Sum_probs=32.2 Q ss_pred ECCEEEEEEEEECCCC-EEEEECCCCCCHHHHHHHHHHHH Q ss_conf 4227899998873898-18998899978889999999871 Q gi|255764514|r 7 YNIVLIESLDIDFSAG-LSILSGDTGSGKSILLDALILVT 45 (554) Q Consensus 7 ~Nf~~i~~~~i~f~~G-l~vItGetGaGKS~ildAl~~~l 45 (554) .+...++++++++.+| +.+|.||+|||||+++..|.-+. T Consensus 11 ~~~~~l~~vs~~i~~Ge~~~ivGpSG~GKSTllr~i~Gl~ 50 (178) T cd03229 11 GQKTVLNDVSLNIEAGEIVALLGPSGSGKSTLLRCIAGLE 50 (178) T ss_pred CCEEEECCCEEEECCCCEEEEECCCCCHHHHHHHHHHCCC T ss_conf 9999983707698899899999999983999999998599 No 402 >cd03301 ABC_MalK_N The N-terminal ATPase domain of the maltose transporter, MalK. ATP binding cassette (ABC) proteins function from bacteria to human, mediating the translocation of substances into and out of cells or organelles. ABC transporters contain two transmembrane-spanning domains (TMDs) or subunits and two nucleotide binding domains (NBDs) or subunits that couple transport to the hydrolysis of ATP. In the maltose transport system, the periplasmic maltose binding protein (MBP) stimulates the ATPase activity of the membrane-associated transporter, which consists of two transmembrane subunits, MalF and MalG, and two copies of the ATP binding subunit, MalK, and becomes tightly bound to the transporter in the catalytic transition state, ensuring that maltose is passed to the transporter as ATP is hydrolyzed. Probab=97.61 E-value=0.0001 Score=49.97 Aligned_cols=38 Identities=26% Similarity=0.542 Sum_probs=31.1 Q ss_pred ECCEEEEEEEEECCCC-EEEEECCCCCCHHHHHHHHHHH Q ss_conf 4227899998873898-1899889997888999999987 Q gi|255764514|r 7 YNIVLIESLDIDFSAG-LSILSGDTGSGKSILLDALILV 44 (554) Q Consensus 7 ~Nf~~i~~~~i~f~~G-l~vItGetGaGKS~ildAl~~~ 44 (554) .+...+++++++..+| +.+|.||+|||||+++..|.-+ T Consensus 11 ~~~~~l~~isl~v~~Ge~~~i~GpSG~GKSTlLr~iaGl 49 (213) T cd03301 11 GNVTALDDLNLDIADGEFVVLLGPSGCGKTTTLRMIAGL 49 (213) T ss_pred CCEEEECCCEEEECCCCEEEEECCCCCHHHHHHHHHHCC T ss_conf 999998761779869989999999988099999999769 No 403 >PRK13657 cyclic beta-1,2-glucan ABC transporter; Provisional Probab=97.60 E-value=6.1e-05 Score=51.52 Aligned_cols=121 Identities=20% Similarity=0.179 Sum_probs=53.2 Q ss_pred CCCCCEEEEECCCCCCCCHHHHHHCCHHHHHHHHHHHHHHCCCCC-CCEEEEECCCCC-CCHHHHHHHHHHHHHHHHCCC Q ss_conf 543200110127899831135440621579999999998436689-976998034468-887999999999999730593 Q gi|255764514|r 405 GIDRVEFYVQTNRGENPGPLMKLASGGELSRFLLALKIVLVDQGS-IPTLVFDEVDSG-IGGAVADAIGYRLKQLSKKIQ 482 (554) Q Consensus 405 G~d~v~f~~s~n~g~~~~pl~kiaSGGE~Sr~~LAl~~~~~~~~~-~p~~ifDEiDag-i~G~~a~~v~~~l~~ls~~~Q 482 (554) ..++|.|-+. ||+...=.+ .||.=|| +++.+..-+ ++| .....+|.+|-. ++- ..+-+.+--.+++.. T Consensus 350 vL~~isl~i~--~Ge~vaiVG--~SGsGKS-TL~~LL~gl--y~p~~G~I~idg~di~~i~~---~~lR~~i~~V~Q~~~ 419 (585) T PRK13657 350 AVEDVSFEAK--PGQTVAIVG--PTGAGKS-TLINLLHRV--FDPQSGRIRIDGTDIRTVTR---ASLRRNIGVVFQEAG 419 (585) T ss_pred CCCCCEEEEC--CCCEEEEEC--CCCCCHH-HHHHHHHHH--CCCCCCCEEECCEECHHCCH---HHHHHHCCEECCCCC T ss_conf 5367038975--998899988--9898699-999998601--57887967589896101689---999852522166763 Q ss_pred EEE-------------EEC--HHHHHHHCCCEEEEEEEECCCCCCEEEEEEEECCHHHHH-HHHHHHHCC Q ss_conf 999-------------808--379865017617999962168752589999975988999-999998668 Q gi|255764514|r 483 LLA-------------VTH--APQVAARADRHFLVYKTNKPDDTQRIETYVAVLTPQERR-EEIARMLAG 536 (554) Q Consensus 483 vi~-------------ITH--~pqvAa~a~~h~~v~K~~~~~~~~~~~~~i~~l~~~~r~-~Eiarml~g 536 (554) ++- +|. .-..+..|+-|=.|..-..+-+|.... .=..|++-+|. --|||.+-- T Consensus 420 LF~gTI~eNI~~g~~~~sd~ei~~a~~~a~~~~~I~~lp~G~dT~vge-~G~~LSGGQrQRialARAll~ 488 (585) T PRK13657 420 LFNRSIEDNLRVGRPDATDEEMRAAAERAQALDFIERKEDGYDTVVGE-RGRQLSGGERQRLAIARALLK 488 (585) T ss_pred CCCHHHHHHHHCCCCCCCHHHHHHHHHHHCCHHHHHHCCCCCCCCCCC-CCCCCCHHHHHHHHHHHHHHC T ss_conf 547659988752799998688999999843279997175666680137-888689999999999999946 No 404 >PRK11650 ugpC glycerol-3-phosphate transporter ATP-binding subunit; Provisional Probab=97.60 E-value=0.00057 Score=45.10 Aligned_cols=36 Identities=33% Similarity=0.607 Sum_probs=30.1 Q ss_pred EEEEEEEEECCCC-EEEEECCCCCCHHHHHHHHHHHH Q ss_conf 7899998873898-18998899978889999999871 Q gi|255764514|r 10 VLIESLDIDFSAG-LSILSGDTGSGKSILLDALILVT 45 (554) Q Consensus 10 ~~i~~~~i~f~~G-l~vItGetGaGKS~ildAl~~~l 45 (554) ..+++++++..+| +.+|.||||||||+++..|.-+. T Consensus 18 ~al~~vsl~i~~Ge~~~llGpsG~GKTTllr~iaGl~ 54 (358) T PRK11650 18 QVIKGIDLDVADGEFIVLVGPSGCGKSTLLRMVAGLE 54 (358) T ss_pred EEEECCEEEECCCCEEEEECCCCCHHHHHHHHHHCCC T ss_conf 7982527798899899999998636999999997699 No 405 >COG4938 Uncharacterized conserved protein [Function unknown] Probab=97.59 E-value=0.0001 Score=49.98 Aligned_cols=46 Identities=28% Similarity=0.386 Sum_probs=41.9 Q ss_pred CCEEEEECCEEEEEEEEECCCCEEEEECCCCCCHHHHHHHHHHHHCC Q ss_conf 92599942278999988738981899889997888999999987147 Q gi|255764514|r 1 MTRLSIYNIVLIESLDIDFSAGLSILSGDTGSGKSILLDALILVTGG 47 (554) Q Consensus 1 L~~L~i~Nf~~i~~~~i~f~~Gl~vItGetGaGKS~ildAl~~~lG~ 47 (554) +.+|+++||.++....|.+.| +||++|+|-||||+.+-||.+..-+ T Consensus 2 i~sl~l~nfk~y~n~~i~l~~-ltVF~G~NssGKSt~iqsl~li~s~ 47 (374) T COG4938 2 ILSLSLKNFKPYINGKIILKP-LTVFIGPNSSGKSTTIQSLYLIYSG 47 (374) T ss_pred CCEEEECCCCCEECCEEEEEC-CEEEECCCCCCHHHHHHHHHHHHHH T ss_conf 533663475331245699852-3699767877604899999999976 No 406 >PRK00409 recombination and DNA strand exchange inhibitor protein; Reviewed Probab=97.59 E-value=0.0068 Score=38.03 Aligned_cols=109 Identities=19% Similarity=0.202 Sum_probs=41.0 Q ss_pred HHHHHHHCCCCCCCEEEEECCCCCCC----HHHHHHHHHHHHHHHHCCCEEEEECHHHHHHHCCCEEEEEEEEC--CCCC Q ss_conf 99999843668997699803446888----79999999999997305939998083798650176179999621--6875 Q gi|255764514|r 438 LALKIVLVDQGSIPTLVFDEVDSGIG----GAVADAIGYRLKQLSKKIQLLAVTHAPQVAARADRHFLVYKTNK--PDDT 511 (554) Q Consensus 438 LAl~~~~~~~~~~p~~ifDEiDagi~----G~~a~~v~~~l~~ls~~~Qvi~ITH~pqvAa~a~~h~~v~K~~~--~~~~ 511 (554) .-|+.++...++-...++||+-+|.+ +.-|..|-+.|. .+.+-+|+-||.+.+.++|..|=-|.=-.. |.+| T Consensus 394 ~~i~~il~~a~~~sLVLlDElG~GTDP~EGaALa~aile~l~--~~~~~~i~TTH~~~lK~~a~~~~~~~nas~~FD~~t 471 (780) T PRK00409 394 TNIVRILEKADENSLVLFDELGAGTDPDEGAALAISILDYLR--KRGAKIIATTHYKELKALKYNREGVENASVEFDEET 471 (780) T ss_pred HHHHHHHHHCCCCEEEEECCCCCCCCHHHHHHHHHHHHHHHH--HCCCEEEEECCHHHHHHHHHCCCCCEEEEEEECCCC T ss_conf 999999973899808812323589984565999999999999--779979994776999999727998189888874023 Q ss_pred CE-EEEEEEECCHHHHHHHHHHHHCCCCCHHHHHHHHHHHH Q ss_conf 25-89999975988999999998668800289999999887 Q gi|255764514|r 512 QR-IETYVAVLTPQERREEIARMLAGSHITEEARAAAEILL 551 (554) Q Consensus 512 ~~-~~~~i~~l~~~~r~~Eiarml~g~~~~~~~~~~A~~ll 551 (554) -+ ||.-+.=..+..---|||+=+| +.+.-++-|+++| T Consensus 472 l~PtYrl~~G~pG~S~A~~IA~rlG---lp~~ii~~A~~~l 509 (780) T PRK00409 472 LRPTYRLLIGIPGRSNAFEIAKRLG---LPPNIIEEAKKVY 509 (780) T ss_pred CCCCEEEECCCCCCCHHHHHHHHHC---CCHHHHHHHHHHH T ss_conf 7860687059997636999999929---7999999999885 No 407 >PRK13536 nodulation factor exporter subunit NodI; Provisional Probab=97.59 E-value=0.00013 Score=49.37 Aligned_cols=39 Identities=23% Similarity=0.338 Sum_probs=31.8 Q ss_pred ECCEEEEEEEEECCCC-EEEEECCCCCCHHHHHHHHHHHH Q ss_conf 4227899998873898-18998899978889999999871 Q gi|255764514|r 7 YNIVLIESLDIDFSAG-LSILSGDTGSGKSILLDALILVT 45 (554) Q Consensus 7 ~Nf~~i~~~~i~f~~G-l~vItGetGaGKS~ildAl~~~l 45 (554) .++..+++++++..+| +..+.||||||||+++..|.-++ T Consensus 18 g~~~al~~vs~~v~~Gei~gllGpNGAGKSTli~~l~Gl~ 57 (306) T PRK13536 18 GDKPVVNGLSFTVASGECFGLLGPNGAGKSTIARMILGMT 57 (306) T ss_pred CCEEEECCEEEEECCCCEEEEECCCCCCHHHHHHHHHCCC T ss_conf 9999871617788599699999998980999999996795 No 408 >PRK10522 multidrug transporter membrane component/ATP-binding component; Provisional Probab=97.58 E-value=6.8e-05 Score=51.19 Aligned_cols=48 Identities=17% Similarity=0.104 Sum_probs=26.2 Q ss_pred CCCCEEEEECCCCCCCCHHHHHHCCHHHHHHHHHHHHHHCCCCC-CCEEEEECCCC Q ss_conf 43200110127899831135440621579999999998436689-97699803446 Q gi|255764514|r 406 IDRVEFYVQTNRGENPGPLMKLASGGELSRFLLALKIVLVDQGS-IPTLVFDEVDS 460 (554) Q Consensus 406 ~d~v~f~~s~n~g~~~~pl~kiaSGGE~Sr~~LAl~~~~~~~~~-~p~~ifDEiDa 460 (554) .++|.|.+ +||+...=.+ .||.=|| +++.|..- -++| .....+|.+|- T Consensus 339 L~~isl~i--~~Ge~vaiVG--~SGsGKS-TL~~LL~r--~y~p~~G~I~idG~di 387 (547) T PRK10522 339 VGPINLTI--KRGELLFLIG--GNGSGKS-TLAMLLTG--LYQPQSGEILLDGKPV 387 (547) T ss_pred CCCEEEEE--CCCCEEEEEC--CCCCCHH-HHHHHHHC--CCCCCCCEEEECCEEC T ss_conf 07804798--5998899989--9999779-99999828--9669998698999999 No 409 >TIGR02857 CydD ABC transporter, CydDC cysteine exporter (CydDC-E) family, permease/ATP-binding protein CydD; InterPro: IPR014216 The gene pair cydCD encodes an ABC-family transporter in which each gene contains an N-terminal membrane-spanning domain and a C-terminal ATP-binding domain. In Escherichia coli these genes were discovered as mutants which caused the terminal heme-copper oxidase complex cytochrome bd to fail to assemble. Recent work has shown that the transporter is involved in the export of redox-active thiol compounds such as cysteine and glutathione , . The linkage to assembly of the cytochrome bd complex is further supported by the conserved operon structure found outside the gammaproteobacteria (cydABCD) containing both the transporter and oxidase genes components. The genes used as the seed members for this entry are all either found in the gammaproteobacterial context, or the CydABCD context. All members of this entry scoring above the trusted cut off at the time of its creation were from genomes which encode a cytochrome bd complex. Unfortunately, the gene symbol nomenclature, based on this operon in Bacillus subtilis, assigns cydC to the third gene in the operon, where this gene is actually homologous to the E. coli cydD gene. We have chosen to name all homologues in this family in accordance with the precedence of publication of the E. coli name, CydD.. Probab=97.58 E-value=4.3e-05 Score=52.52 Aligned_cols=31 Identities=32% Similarity=0.553 Sum_probs=26.3 Q ss_pred EEEEEEEECCCC-EEEEECCCCCCHHHHHHHH Q ss_conf 899998873898-1899889997888999999 Q gi|255764514|r 11 LIESLDIDFSAG-LSILSGDTGSGKSILLDAL 41 (554) Q Consensus 11 ~i~~~~i~f~~G-l~vItGetGaGKS~ildAl 41 (554) .++.+++.+.|| .++|+|++|||||+||.+| T Consensus 367 a~~~~sf~~~pG~~vAl~G~SGaGKSTLL~lL 398 (570) T TIGR02857 367 ALRPVSFTVEPGERVALVGPSGAGKSTLLNLL 398 (570) T ss_pred CCCCCCEEECCCCEEEEEECCCCCHHHHHHHH T ss_conf 37885416638704888627999788999999 No 410 >TIGR00958 3a01208 antigen peptide transporter 2; InterPro: IPR005293 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems. ABC transporters are minimally constituted of two conserved regions: a highly conserved ATP binding cassette (ABC) and a less conserved transmembrane domain (TMD). These regions can be found on the same protein or on two different ones. Most ABC transporters function as a dimer and therefore are constituted of four domains, two ABC modules and two TMDs. ABC transporters are involved in the export or import of a wide variety of substrates ranging from small ions to macromolecules. The major function of ABC import systems is to provide essential nutrients to bacteria. They are found only in prokaryotes and their four constitutive domains are usually encoded by independent polypeptides (two ABC proteins and two TMD proteins). Prokaryotic importers require additional extracytoplasmic binding proteins (one or more per systems) for function. In contrast, export systems are involved in the extrusion of noxious substances, the export of extracellular toxins and the targeting of membrane components. They are found in all living organisms and in general the TMD is fused to the ABC module in a variety of combinations. Some eukaryotic exporters encode the four domains on the same polypeptide chain . The ABC module (approximately two hundred amino acid residues) is known to bind and hydrolyze ATP, thereby coupling transport to ATP hydrolysis in a large number of biological processes. The cassette is duplicated in several subfamilies. Its primary sequence is highly conserved, displaying a typical phosphate-binding loop: Walker A, and a magnesium binding site: Walker B. Besides these two regions, three other conserved motifs are present in the ABC cassette: the switch region which contains a histidine loop, postulated to polarize the attaching water molecule for hydrolysis, the signature conserved motif (LSGGQ) specific to the ABC transporter, and the Q-motif (between Walker A and the signature), which interacts with the gamma phosphate through a water bond. The Walker A, Walker B, Q-loop and switch region form the nucleotide binding site , , . The 3D structure of a monomeric ABC module adopts a stubby L-shape with two distinct arms. ArmI (mainly beta-strand) contains Walker A and Walker B. The important residues for ATP hydrolysis and/or binding are located in the P-loop. The ATP-binding pocket is located at the extremity of armI. The perpendicular armII contains mostly the alpha helical subdomain with the signature motif. It only seems to be required for structural integrity of the ABC module. ArmII is in direct contact with the TMD. The hinge between armI and armII contains both the histidine loop and the Q-loop, making contact with the gamma phosphate of the ATP molecule. ATP hydrolysis leads to a conformational change that could facilitate ADP release. In the dimer the two ABC cassettes contact each other through hydrophobic interactions at the antiparallel beta-sheet of armI by a two-fold axis , , , , , . Proteins known to belong to this family are classified in several functional subfamilies depending on the substrate used (for further information see http://www.tcdb.org/tcdb/index.php?tc=3.A.1). Proteins of this family are involved in the transport of antigens from the cytoplasm to a membrane-bound compartment for association with MHC class I molecules.; GO: 0005215 transporter activity, 0006810 transport. Probab=97.58 E-value=5.6e-05 Score=51.75 Aligned_cols=77 Identities=25% Similarity=0.317 Sum_probs=62.4 Q ss_pred HHHHCCHHHHHHHHHHHHHHCCCCCCCEEEEEC----CCCCCCHHHHHHHHHHHHHHHHCCCEEEEECHHHHHHHCCCEE Q ss_conf 544062157999999999843668997699803----4468887999999999999730593999808379865017617 Q gi|255764514|r 425 MKLASGGELSRFLLALKIVLVDQGSIPTLVFDE----VDSGIGGAVADAIGYRLKQLSKKIQLLAVTHAPQVAARADRHF 500 (554) Q Consensus 425 ~kiaSGGE~Sr~~LAl~~~~~~~~~~p~~ifDE----iDagi~G~~a~~v~~~l~~ls~~~Qvi~ITH~pqvAa~a~~h~ 500 (554) +.-.|||-+=|+++|=.++ + +| -.+|+|| -||+=-|+.-..+.+-+..-.+.+=||+|+|.=+++-.||+=+ T Consensus 668 G~qlSgGQKQRiAiARALv--R-~P-~vLILDEATSALDa~~~~~~e~~lq~A~~~~~~~rTv~~IahrLstv~~a~~i~ 743 (770) T TIGR00958 668 GSQLSGGQKQRIAIARALV--R-KP-RVLILDEATSALDAESQLEVEQLLQEALSRSRKSRTVLLIAHRLSTVERADKIL 743 (770) T ss_pred CCCCCCHHHHHHHHHHHHH--H-CC-EEEEECCHHHHHCCCCHHHHHHHHHHHHHHHHCCCCEEEEECCCHHHHHCCCEE T ss_conf 8752303899999998875--1-89-057400011021366547899999998635306980899826515765255048 Q ss_pred EEEEE Q ss_conf 99996 Q gi|255764514|r 501 LVYKT 505 (554) Q Consensus 501 ~v~K~ 505 (554) ++.+- T Consensus 744 vl~~G 748 (770) T TIGR00958 744 VLKKG 748 (770) T ss_pred EECCC T ss_conf 73376 No 411 >cd03277 ABC_SMC5_euk Eukaryotic SMC5 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains. Amino-acid sequence homology of SMC proteins between species is largely confined to the amino- and carboxy-terminal globular domains. The amino-terminal domain contains a 'Walker A' nucleotide-binding domain (GxxGxGKS/T, in the single-letter amino-acid code), which by mutational studies has been shown to be essential in several proteins. The carboxy-terminal domain contains a sequence (the DA-box) that resembles a 'Walker B' motif, and a motif with homology to the signature sequence of the ATP-binding cassette (ABC) family of ATPases. The sequence homology within the carboxy-terminal domain is relatively high within the SMC1-SMC4 group, whereas SMC5 and SMC6 show some divergence in both of these sequences. In eukaryotic cells, the proteins are found as heterodimers of SMC1 paired with SMC3, SMC2 with SMC4, and SMC5 with SMC6 (for Probab=97.57 E-value=0.00012 Score=49.52 Aligned_cols=79 Identities=24% Similarity=0.244 Sum_probs=58.8 Q ss_pred EEEEECCCCCCCCHHH-HHHCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHH---CCCEEE Q ss_conf 0110127899831135-440621579999999998436689976998034468887999999999999730---593999 Q gi|255764514|r 410 EFYVQTNRGENPGPLM-KLASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSK---KIQLLA 485 (554) Q Consensus 410 ~f~~s~n~g~~~~pl~-kiaSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~---~~Qvi~ 485 (554) +.+++.-.+..+++|. ..-||||.|-.-.....+++...++||-+.|||.-|.+-.+-..|=++|-+.+. ..|.+. T Consensus 108 eLLVKFRk~~~L~~L~~~~QSGGErsvst~~yllalQ~l~~~pFr~vDEINQgmD~~nEr~v~~~~v~~~~~~~~~QyFl 187 (213) T cd03277 108 ELLVKFREGEQLQELDPHHQSGGERSVSTMLYLLSLQELTRCPFRVVDEINQGMDPTNERKVFDMLVETACKEGTSQYFL 187 (213) T ss_pred HHHHHHHHHCCCCCCCHHHHHCCHHHHHHHHHHHHHHHHHCCCCEEEEHHHCCCCCHHHHHHHHHHHHHHHCCCCCCEEE T ss_conf 99999985203555787787120558999999999977534992785343357981789999999999972799865899 Q ss_pred EEC Q ss_conf 808 Q gi|255764514|r 486 VTH 488 (554) Q Consensus 486 ITH 488 (554) ||- T Consensus 188 iTP 190 (213) T cd03277 188 ITP 190 (213) T ss_pred ECH T ss_conf 870 No 412 >COG1122 CbiO ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism] Probab=97.57 E-value=8.7e-05 Score=50.50 Aligned_cols=37 Identities=30% Similarity=0.456 Sum_probs=32.4 Q ss_pred EEEEEEEEECCCC-EEEEECCCCCCHHHHHHHHHHHHC Q ss_conf 7899998873898-189988999788899999998714 Q gi|255764514|r 10 VLIESLDIDFSAG-LSILSGDTGSGKSILLDALILVTG 46 (554) Q Consensus 10 ~~i~~~~i~f~~G-l~vItGetGaGKS~ildAl~~~lG 46 (554) ..++++++.+.+| +++|+|+||||||+++-.++-++- T Consensus 18 ~~l~~v~~~i~~Ge~~~i~G~nGsGKSTL~~~l~GLl~ 55 (235) T COG1122 18 AALKDVSLEIEKGERVLLIGPNGSGKSTLLKLLNGLLK 55 (235) T ss_pred EEEECCEEEECCCCEEEEECCCCCCHHHHHHHHCCCCC T ss_conf 47625338987898999988999889999999537676 No 413 >PRK11650 ugpC glycerol-3-phosphate transporter ATP-binding subunit; Provisional Probab=97.56 E-value=0.00012 Score=49.65 Aligned_cols=93 Identities=25% Similarity=0.312 Sum_probs=65.4 Q ss_pred HCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHH--CCCEEEEECHHHHHH-HCCCEEEEEE Q ss_conf 0621579999999998436689976998034468887999999999999730--593999808379865-0176179999 Q gi|255764514|r 428 ASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSK--KIQLLAVTHAPQVAA-RADRHFLVYK 504 (554) Q Consensus 428 aSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~--~~Qvi~ITH~pqvAa-~a~~h~~v~K 504 (554) +|||++=|++||-.++ .....++|||.=++++-.....+-..|+++-+ ..-+|.|||-+..|. +||+=.+..+ T Consensus 135 LSGGq~QRvalARAL~----~~P~vlllDEP~s~LD~~~r~~~~~~l~~l~~~~g~T~i~vTHd~~eA~~laDri~vm~~ 210 (358) T PRK11650 135 LSGGQRQRVAMGRAIV----REPAVFLFDEPLSNLDAKLRVQMRLEIQRLHRRLGTTSLYVTHDQVEAMTLADRVVVMNG 210 (358) T ss_pred CCHHHHHHHHHHHHHH----CCCCEEEECCCCCCCCHHHHHHHHHHHHHHHHHHCCEEEEEECCHHHHHHHCCEEEEEEC T ss_conf 8956789999835750----499868873887767998999999999999997597799998999999986999999989 Q ss_pred EECCCCCCEEEEEEEEC-CHHHH-----HHHHHHHHC Q ss_conf 62168752589999975-98899-----999999866 Q gi|255764514|r 505 TNKPDDTQRIETYVAVL-TPQER-----REEIARMLA 535 (554) Q Consensus 505 ~~~~~~~~~~~~~i~~l-~~~~r-----~~Eiarml~ 535 (554) | .|... +++|= -..+|+++| T Consensus 211 ----G-------~i~q~Gtp~eiy~~P~~~fVA~fiG 236 (358) T PRK11650 211 ----G-------VAEQIGTPVEVYEKPASTFVASFIG 236 (358) T ss_pred ----C-------EEEEEECHHHHHHCCCCHHHHHHCC T ss_conf ----9-------8999838999986899859986519 No 414 >TIGR01189 ccmA heme ABC exporter, ATP-binding protein CcmA; InterPro: IPR005895 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems. ABC transporters are minimally constituted of two conserved regions: a highly conserved ATP binding cassette (ABC) and a less conserved transmembrane domain (TMD). These regions can be found on the same protein or on two different ones. Most ABC transporters function as a dimer and therefore are constituted of four domains, two ABC modules and two TMDs. ABC transporters are involved in the export or import of a wide variety of substrates ranging from small ions to macromolecules. The major function of ABC import systems is to provide essential nutrients to bacteria. They are found only in prokaryotes and their four constitutive domains are usually encoded by independent polypeptides (two ABC proteins and two TMD proteins). Prokaryotic importers require additional extracytoplasmic binding proteins (one or more per systems) for function. In contrast, export systems are involved in the extrusion of noxious substances, the export of extracellular toxins and the targeting of membrane components. They are found in all living organisms and in general the TMD is fused to the ABC module in a variety of combinations. Some eukaryotic exporters encode the four domains on the same polypeptide chain . The ABC module (approximately two hundred amino acid residues) is known to bind and hydrolyze ATP, thereby coupling transport to ATP hydrolysis in a large number of biological processes. The cassette is duplicated in several subfamilies. Its primary sequence is highly conserved, displaying a typical phosphate-binding loop: Walker A, and a magnesium binding site: Walker B. Besides these two regions, three other conserved motifs are present in the ABC cassette: the switch region which contains a histidine loop, postulated to polarize the attaching water molecule for hydrolysis, the signature conserved motif (LSGGQ) specific to the ABC transporter, and the Q-motif (between Walker A and the signature), which interacts with the gamma phosphate through a water bond. The Walker A, Walker B, Q-loop and switch region form the nucleotide binding site , , . The 3D structure of a monomeric ABC module adopts a stubby L-shape with two distinct arms. ArmI (mainly beta-strand) contains Walker A and Walker B. The important residues for ATP hydrolysis and/or binding are located in the P-loop. The ATP-binding pocket is located at the extremity of armI. The perpendicular armII contains mostly the alpha helical subdomain with the signature motif. It only seems to be required for structural integrity of the ABC module. ArmII is in direct contact with the TMD. The hinge between armI and armII contains both the histidine loop and the Q-loop, making contact with the gamma phosphate of the ATP molecule. ATP hydrolysis leads to a conformational change that could facilitate ADP release. In the dimer the two ABC cassettes contact each other through hydrophobic interactions at the antiparallel beta-sheet of armI by a two-fold axis , , , , , . Proteins known to belong to this family are classified in several functional subfamilies depending on the substrate used (for further information see http://www.tcdb.org/tcdb/index.php?tc=3.A.1). This family contains the cytochrome c biogenesis protein encoded by ccmA in bacteria and one arabidopsis protein, possibly encoded by an organelle. Bacterial c-type cytochromes are located on the periplasmic side of the cytoplasmic membrane. Several gene products encoded in a locus designated as 'ccm' are implicated in the transport and assembly of the functional cytochrome C. This cluster includes genes: ccmA;B;C;D;E;F;G and H. The post-translational pathway includes the transport of a heme moiety, the secretion of the apoprotein and the covalent attachment of the heme with the apoprotein. The proteins ccmA and B represent an ABC transporter; ccmC and D participate in heme transfer to ccmE, which functions as a periplasmic heme chaperone. The presence of ccmF, G and H is suggested to be obligatory for the final functional assembly of cytochrome c.; GO: 0005215 transporter activity, 0017004 cytochrome complex assembly, 0030288 outer membrane-bounded periplasmic space. Probab=97.55 E-value=9.5e-05 Score=50.25 Aligned_cols=36 Identities=36% Similarity=0.507 Sum_probs=30.2 Q ss_pred EEEEEEEEECCCC-EEEEECCCCCCHHHHHHHHHHHH Q ss_conf 7899998873898-18998899978889999999871 Q gi|255764514|r 10 VLIESLDIDFSAG-LSILSGDTGSGKSILLDALILVT 45 (554) Q Consensus 10 ~~i~~~~i~f~~G-l~vItGetGaGKS~ildAl~~~l 45 (554) .+|..+++++.+| +-+|+||||+|||+||-=|.=++ T Consensus 14 ~~f~~l~F~l~aGe~l~v~GpNG~GKTtLLR~LAGL~ 50 (204) T TIGR01189 14 VLFEGLSFTLNAGEALQVEGPNGIGKTTLLRILAGLL 50 (204) T ss_pred EEECCCEEEEECCCEEEEEECCCCCHHHHHHHHHHCC T ss_conf 2301123454078278986069873578999998505 No 415 >TIGR03269 met_CoM_red_A2 methyl coenzyme M reductase system, component A2. The enzyme that catalyzes the final step in methanogenesis, methyl coenzyme M reductase, contains alpha, beta, and gamma chains. In older literature, the complex of alpha, beta, and gamma chains was termed component C, while this single chain protein was termed methyl coenzyme M reductase system component A2. Probab=97.54 E-value=0.0012 Score=42.91 Aligned_cols=37 Identities=22% Similarity=0.432 Sum_probs=31.1 Q ss_pred CCEEEEEEEEECCCC-EEEEECCCCCCHHHHHHHHHHH Q ss_conf 227899998873898-1899889997888999999987 Q gi|255764514|r 8 NIVLIESLDIDFSAG-LSILSGDTGSGKSILLDALILV 44 (554) Q Consensus 8 Nf~~i~~~~i~f~~G-l~vItGetGaGKS~ildAl~~~ 44 (554) +....+++++++.+| +.+|+||||||||+++.+|.-+ T Consensus 12 ~~~aL~~vsl~i~~Gei~~LvG~sGsGKSTL~~~l~Gl 49 (520) T TIGR03269 12 GKEVLKNISFTIEEGEVLGILGRSGAGKSVLMHVLRGM 49 (520) T ss_pred CEEEECCEEEEECCCCEEEEECCCCCHHHHHHHHHHCC T ss_conf 99988671779999989999999996999999999651 No 416 >TIGR02868 CydC ABC transporter, CydDC cysteine exporter (CydDC-E) family, permease/ATP-binding protein CydC; InterPro: IPR014223 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems. ABC transporters are minimally constituted of two conserved regions: a highly conserved ATP binding cassette (ABC) and a less conserved transmembrane domain (TMD). These regions can be found on the same protein or on two different ones. Most ABC transporters function as a dimer and therefore are constituted of four domains, two ABC modules and two TMDs. ABC transporters are involved in the export or import of a wide variety of substrates ranging from small ions to macromolecules. The major function of ABC import systems is to provide essential nutrients to bacteria. They are found only in prokaryotes and their four constitutive domains are usually encoded by independent polypeptides (two ABC proteins and two TMD proteins). Prokaryotic importers require additional extracytoplasmic binding proteins (one or more per systems) for function. In contrast, export systems are involved in the extrusion of noxious substances, the export of extracellular toxins and the targeting of membrane components. They are found in all living organisms and in general the TMD is fused to the ABC module in a variety of combinations. Some eukaryotic exporters encode the four domains on the same polypeptide chain . The ABC module (approximately two hundred amino acid residues) is known to bind and hydrolyze ATP, thereby coupling transport to ATP hydrolysis in a large number of biological processes. The cassette is duplicated in several subfamilies. Its primary sequence is highly conserved, displaying a typical phosphate-binding loop: Walker A, and a magnesium binding site: Walker B. Besides these two regions, three other conserved motifs are present in the ABC cassette: the switch region which contains a histidine loop, postulated to polarize the attaching water molecule for hydrolysis, the signature conserved motif (LSGGQ) specific to the ABC transporter, and the Q-motif (between Walker A and the signature), which interacts with the gamma phosphate through a water bond. The Walker A, Walker B, Q-loop and switch region form the nucleotide binding site , , . The 3D structure of a monomeric ABC module adopts a stubby L-shape with two distinct arms. ArmI (mainly beta-strand) contains Walker A and Walker B. The important residues for ATP hydrolysis and/or binding are located in the P-loop. The ATP-binding pocket is located at the extremity of armI. The perpendicular armII contains mostly the alpha helical subdomain with the signature motif. It only seems to be required for structural integrity of the ABC module. ArmII is in direct contact with the TMD. The hinge between armI and armII contains both the histidine loop and the Q-loop, making contact with the gamma phosphate of the ATP molecule. ATP hydrolysis leads to a conformational change that could facilitate ADP release. In the dimer the two ABC cassettes contact each other through hydrophobic interactions at the antiparallel beta-sheet of armI by a two-fold axis , , , , , . Proteins known to belong to this family are classified in several functional subfamilies depending on the substrate used (for further information see http://www.tcdb.org/tcdb/index.php?tc=3.A.1). This entry represents CydC, a member of a heterodimeric ATP-binding cassette-type transporter (ABC transporter). It is involved in the export of glutathione from the cytoplasm to the periplasm and is required for the assembly of both cytochrome c and cytochrome bd , , .; GO: 0042626 ATPase activity coupled to transmembrane movement of substances, 0006810 transport, 0016021 integral to membrane. Probab=97.54 E-value=0.00028 Score=47.18 Aligned_cols=64 Identities=25% Similarity=0.266 Sum_probs=49.5 Q ss_pred HHHHHHCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHH-HHHHCCC-----EEEEECHH Q ss_conf 13544062157999999999843668997699803446888799999999999-9730593-----99980837 Q gi|255764514|r 423 PLMKLASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLK-QLSKKIQ-----LLAVTHAP 490 (554) Q Consensus 423 pl~kiaSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~-~ls~~~Q-----vi~ITH~p 490 (554) +-.+..||||.=|++||=-++ .+.|.+|+||-=.+++=.|+..+=+.|- .=....- |++|||.| T Consensus 497 e~G~~lSGGeRqRLALARaLl----~~ap~llLDEPTehLDa~t~~~ll~dL~t~a~~g~t~~~R~vvliTH~L 566 (566) T TIGR02868 497 EGGARLSGGERQRLALARALL----ADAPILLLDEPTEHLDAETADELLEDLLTAALSGRTESARAVVLITHHL 566 (566) T ss_pred CCCCCCCHHHHHHHHHHHHHH----CCCCEEEECCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCCEEEEEEECC T ss_conf 564301048999999999973----7998898608866678767999999985055446558987489875069 No 417 >PRK11607 potG putrescine transporter ATP-binding subunit; Provisional Probab=97.54 E-value=0.00012 Score=49.54 Aligned_cols=37 Identities=27% Similarity=0.401 Sum_probs=30.3 Q ss_pred CEEEEEEEEECCCC-EEEEECCCCCCHHHHHHHHHHHH Q ss_conf 27899998873898-18998899978889999999871 Q gi|255764514|r 9 IVLIESLDIDFSAG-LSILSGDTGSGKSILLDALILVT 45 (554) Q Consensus 9 f~~i~~~~i~f~~G-l~vItGetGaGKS~ildAl~~~l 45 (554) +..+++++++..+| +.+|.||||||||+++..|.-++ T Consensus 32 ~~al~~vsl~I~~GE~~~llGpsGsGKSTllr~i~Gl~ 69 (377) T PRK11607 32 QHAVDDVSLTIYKGEIFALLGASGCGKSTLLRMLAGFE 69 (377) T ss_pred EEEECCCEEEECCCCEEEEECCCCCHHHHHHHHHHCCC T ss_conf 99990518799999899999999848999999997699 No 418 >cd03236 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 of RNase L inhibitor. The ABC ATPase, RNase L inhibitor (RLI), is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids. RLI s are not transport proteins and thus cluster with a group of soluble proteins that lack the transmembrane components commonly found in other members of the family. Structurally, RLIs have an N-terminal Fe-S domain and two nucleotide binding domains which are arranged to form two composite active sites in their interface cleft. RLI is one of the most conserved enzymes between archaea and eukaryotes with a sequence identity more than 48%. The high degree of evolutionary conservation suggests that RLI performs a central role in archaeal and eukaryotic physiology. Probab=97.53 E-value=7.6e-05 Score=50.87 Aligned_cols=37 Identities=32% Similarity=0.302 Sum_probs=26.9 Q ss_pred EC-CEEEEEEEEECCCC-EEEEECCCCCCHHHHHHHHHHHH Q ss_conf 42-27899998873898-18998899978889999999871 Q gi|255764514|r 7 YN-IVLIESLDIDFSAG-LSILSGDTGSGKSILLDALILVT 45 (554) Q Consensus 7 ~N-f~~i~~~~i~f~~G-l~vItGetGaGKS~ildAl~~~l 45 (554) .| |++++ ++|. .+| +++|+||||||||+++..|.-.+ T Consensus 12 ~~~~~l~~-L~ip-k~GEi~gLiGpNGaGKSTLlk~i~Gll 50 (255) T cd03236 12 PNSFKLHR-LPVP-REGQVLGLVGPNGIGKSTALKILAGKL 50 (255) T ss_pred CCCEEEEC-CCCC-CCCEEEEEECCCCCCHHHHHHHHHCCC T ss_conf 99736517-8989-898099998999970999999996798 No 419 >PRK11160 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Probab=97.52 E-value=9.8e-05 Score=50.15 Aligned_cols=116 Identities=18% Similarity=0.193 Sum_probs=54.3 Q ss_pred CCCCEEEEECCCCCCCCHHHHHHCCHHHHHHHHHHHHHHCCCCC-CCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCEE Q ss_conf 43200110127899831135440621579999999998436689-97699803446888799999999999973059399 Q gi|255764514|r 406 IDRVEFYVQTNRGENPGPLMKLASGGELSRFLLALKIVLVDQGS-IPTLVFDEVDSGIGGAVADAIGYRLKQLSKKIQLL 484 (554) Q Consensus 406 ~d~v~f~~s~n~g~~~~pl~kiaSGGE~Sr~~LAl~~~~~~~~~-~p~~ifDEiDagi~G~~a~~v~~~l~~ls~~~Qvi 484 (554) .+.|.|-+. ||+...=. -.||.=|| +.+.+..-+ ++| .....+|-+|.. .-....+-+.+.=..++..++ T Consensus 357 L~~isl~i~--~Ge~vaiV--G~SGsGKS-TL~~LL~r~--ydp~~G~I~idG~di~--~~~~~~lr~~i~~V~Q~~~LF 427 (575) T PRK11160 357 LKGLSLQIK--AGEKVALL--GRTGCGKS-TLLQLLTRA--WDPQQGEILLNGQPIA--SYSEAALRQAISVVSQRVHLF 427 (575) T ss_pred CCCEEEEEC--CCCEEEEE--CCCCCCHH-HHHHHHHCC--CCCCCCEEEECCEECC--CCCHHHHHHHHCCCCCCCCCC T ss_conf 367158976--99889998--89997599-999998623--6789988999989756--388899987613567776025 Q ss_pred EEE-------------C--HHHHHHHCCCEEEEEEEECCCCCCEEEEEE----EECCHHHHH-HHHHHHHCC Q ss_conf 980-------------8--379865017617999962168752589999----975988999-999998668 Q gi|255764514|r 485 AVT-------------H--APQVAARADRHFLVYKTNKPDDTQRIETYV----AVLTPQERR-EEIARMLAG 536 (554) Q Consensus 485 ~IT-------------H--~pqvAa~a~~h~~v~K~~~~~~~~~~~~~i----~~l~~~~r~-~Eiarml~g 536 (554) -=| . .-+++.++.-+..+.. . ++- .|.| ..|++-+|. --|||.+=- T Consensus 428 ~~TI~eNi~~g~~~atdee~~~al~~a~l~~~~~~-p-~Gl----dT~vGe~G~~LSGGQrQRiaiARAll~ 493 (575) T PRK11160 428 SGTLRDNLLLAAPNATDEALIEVLQQVGLEKLLEG-D-KGL----DAWLGEGGRQLSGGEQRRLGIARALLH 493 (575) T ss_pred CCCHHHHHHHCCCCCCHHHHHHHHHHHCCHHHHHC-C-CCC----CCCCCCCCCCCCHHHHHHHHHHHHHHC T ss_conf 88678998725898789999999975370645636-7-653----450378899599999999999999945 No 420 >PRK13536 nodulation factor exporter subunit NodI; Provisional Probab=97.52 E-value=0.001 Score=43.45 Aligned_cols=74 Identities=28% Similarity=0.325 Sum_probs=59.6 Q ss_pred HHCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHH-CCCEEEEECHHHHHHH-CCCEEEEEE Q ss_conf 40621579999999998436689976998034468887999999999999730-5939998083798650-176179999 Q gi|255764514|r 427 LASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSK-KIQLLAVTHAPQVAAR-ADRHFLVYK 504 (554) Q Consensus 427 iaSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~-~~Qvi~ITH~pqvAa~-a~~h~~v~K 504 (554) -+|||.+-|+++|..++ ..++.+++||.=+|++-.....+-++|+++.+ ..=||.+||.-.-|.. +|+-..+.+ T Consensus 138 ~lSgG~kqrl~iA~aL~----~~P~lliLDEPT~GLDp~~r~~i~~~i~~l~~~G~TillttH~l~E~e~lcdrv~im~~ 213 (306) T PRK13536 138 DLSGGMKRRLTLARALI----NDPQLLILDEPTTGLDPHARHLIWERLRSLLARGKTILLTTHFMEEAERLCDRLCVLEA 213 (306) T ss_pred HCCHHHHHHHHHHHHHH----CCCCEEEECCCCCCCCHHHHHHHHHHHHHHHHCCCEEEEECCCHHHHHHHCCEEEEEEC T ss_conf 78998999999999995----59989997587567899999999999999996898999988838999986999999979 No 421 >TIGR03007 pepcterm_ChnLen polysaccharide chain length determinant protein, PEP-CTERM locus subfamily; InterPro: IPR014345 Members of this entry belong to the family of polysaccharide chain length determinant proteins. They are found in species that encode the PEP-CTERM/exosortase system and are predicted to act in protein sorting in a number of Gram-negative bacteria, they are also found near the epsH homologue that is the putative exosortase gene.. Probab=97.52 E-value=0.0084 Score=37.42 Aligned_cols=260 Identities=18% Similarity=0.205 Sum_probs=102.2 Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHH-HH--HHH---HHHHHHHHCCCHHHHHHHHH-HHHHHHHHHHCCCCCCCCCH-- Q ss_conf 89999999999999988877665555-43--344---44332110000023443346-77788898620001232102-- Q gi|255764514|r 155 LCELGTLYRHWCCTADALKKYQEQKS-SS--QDV---EFLRFSIDELQALAVQPGEE-NELVVMRSKILKQERIAVEL-- 225 (554) Q Consensus 155 ~~~~~~~~~~~~~~~~~l~~l~~~~~-~~--~e~---e~l~~ql~El~~~~l~~~E~-e~L~~~~~~l~~~e~l~~~l-- 225 (554) -++++...+.+.+.+.+|..+..+.- .. +.- +.+..--++|+++.+...|- ..+...++.|...+.....- T Consensus 167 ~~Qik~Y~~kL~~aE~~L~~FK~~~~~~lp~~~~~y~~~l~~~~~~L~~~~l~~~e~~~~Rd~l~rQL~g~~Pv~~~~~g 246 (510) T TIGR03007 167 DEQIKEYEKKLEAAENRLKAFKQENGGILPDQEGDYYSELSEAQEELEAARLELNEAKAQRDALKRQLAGEEPVLLAGSG 246 (510) T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCEEECCCC T ss_conf 99999999999999999998768734537797378999999999999999999998887678875145886615623688 Q ss_pred --HHHHHHHHCCCCHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHCCCHHHHHHHHHHHH----------HHHCCCH- Q ss_conf --345553200100179999999865431001100136676422210010799999998753----------0001487- Q gi|255764514|r 226 --SSIMDDFHKSSSPISVISSMLRRLERKSTEVPDLLQKSISFLNEAQENLSDAQHEIERSF----------SEIQYDA- 292 (554) Q Consensus 226 --~~~~~~l~~~~~~l~~l~~~~~~l~~~~~~~~~~l~~~~~~l~~~~~~l~e~~~el~~~~----------~~le~~~- 292 (554) ....-........+..++..+..|.-...+.....-.....+.....+... +++.+. .....|| T Consensus 247 ~~~~~s~~~~~~~~Ri~~L~~~Ld~L~l~YTd~HPdv~~~k~~Ia~L~~~~~~---e~~~~~~Q~~~~~~~~~~~~~nPv 323 (510) T TIGR03007 247 EKSASSVANSELDSRIEALEKQLDALRLRYTDKHPDVIATKREIAQLEEQKEE---ELESYRKQNGEGGGSEKGSIYNPV 323 (510) T ss_pred CCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHH---HHHHHHHHCCCCCCCCCCCCCCCH T ss_conf 86653123562568999999999986336301155899999999999999889---998898730345555566789831 Q ss_pred -----HHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH Q ss_conf -----640123566678888787620111568887520000266644334577777888887676521113667899999 Q gi|255764514|r 293 -----QELANIEERLFALRAMSRKYSVSIDQLPELAKKMEEDLADISEGNEKVVSLERVLYEARQAYDRVAQDISTKRYQ 367 (554) Q Consensus 293 -----~~L~~ie~Rl~~l~~L~rK~~~~~eel~~~~~~l~~~l~~l~~~~~~l~~l~~~~~~~~~~l~~~a~~Ls~~R~~ 367 (554) ..+.+++..++.++.- ..++....++++..+..+-..+.++..|.....--+..|+++ -.|++ T Consensus 324 yQql~~~l~~~eA~~asl~~r-------~~~~~~~~~~l~~~~~~iP~veaEl~~L~rdy~~~k~~Ye~L-----l~R~e 391 (510) T TIGR03007 324 YQQLQIELAEAEAEIASLEAR-------VAELTARIERLESLLRTIPEVEAELTQLNRDYEVNKSNYEQL-----LARRE 391 (510) T ss_pred HHHHHHHHHHHHHHHHHHHHH-------HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-----HHHHH T ss_conf 377899999999999999999-------999999999999997532799999999998875558889999-----98898 Q ss_pred HHHHHHHHHHHHHHHHCCCCCEEEEEEECCCCCCCCCCCCCCEEEEECCCCCCCCHHHHHHCCHHHHHHHHHHHHHHCCC Q ss_conf 99888999997666520256337865202532234465432001101278998311354406215799999999984366 Q gi|255764514|r 368 FAKMLEKNVMAEMPALKLENVCFTVNITSDKEDISPDGIDRVEFYVQTNRGENPGPLMKLASGGELSRFLLALKIVLVDQ 447 (554) Q Consensus 368 ~a~~L~~~i~~~L~~L~m~~a~f~i~~~~~~~~~~~~G~d~v~f~~s~n~g~~~~pl~kiaSGGE~Sr~~LAl~~~~~~~ 447 (554) .| ++++++..+ =+...|.| +.|.--+..|.|.|+.-|+. +. .=||=.. .+|+.|++... T Consensus 392 ~A-~~S~~~e~~-----~~~v~FRv-iDPP~~P~~PsgP~R~ll~~----------~~--~~~Glg~--G~gl~fl~sql 450 (510) T TIGR03007 392 SA-EVSKQMEVQ-----DKAVSFRV-IDPPIVPSKPSGPNRPLLLL----------AV--LLGGLGA--GIGLAFLLSQL 450 (510) T ss_pred HH-HHHHHEEEE-----CCCEEEEE-ECCCCCCCCCCCCCHHHHHH----------HH--HHHHHHH--HHHHHHHHHHC T ss_conf 55-553303320-----67024677-56756789999878899999----------99--9999999--99999999841 Q ss_pred CCC Q ss_conf 899 Q gi|255764514|r 448 GSI 450 (554) Q Consensus 448 ~~~ 450 (554) +|. T Consensus 451 ~p~ 453 (510) T TIGR03007 451 RPT 453 (510) T ss_pred CCC T ss_conf 787 No 422 >COG1117 PstB ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism] Probab=97.51 E-value=0.00049 Score=45.56 Aligned_cols=40 Identities=25% Similarity=0.399 Sum_probs=28.1 Q ss_pred EEECCEEEEEEEEECCCC-EEEEECCCCCCHHHHHHHHHHH Q ss_conf 994227899998873898-1899889997888999999987 Q gi|255764514|r 5 SIYNIVLIESLDIDFSAG-LSILSGDTGSGKSILLDALILV 44 (554) Q Consensus 5 ~i~Nf~~i~~~~i~f~~G-l~vItGetGaGKS~ildAl~~~ 44 (554) +.-++..++++++++.++ .|+|+||+|+|||++|..++-. T Consensus 16 yYg~~~aL~~i~l~i~~~~VTAlIGPSGcGKST~LR~lNRm 56 (253) T COG1117 16 YYGDKHALKDINLDIPKNKVTALIGPSGCGKSTLLRCLNRM 56 (253) T ss_pred EECCHHHHCCCCEECCCCCEEEEECCCCCCHHHHHHHHHHH T ss_conf 98741123157221457806998889886788899998754 No 423 >KOG0962 consensus Probab=97.51 E-value=0.0087 Score=37.33 Aligned_cols=79 Identities=19% Similarity=0.347 Sum_probs=58.5 Q ss_pred CCHHHHHHHHHHHHHHCCC--CCCCEEEEECCCCCCCHHHHHHHHHHHHHH------HHCCCEEEEECHHHH------HH Q ss_conf 6215799999999984366--899769980344688879999999999997------305939998083798------65 Q gi|255764514|r 429 SGGELSRFLLALKIVLVDQ--GSIPTLVFDEVDSGIGGAVADAIGYRLKQL------SKKIQLLAVTHAPQV------AA 494 (554) Q Consensus 429 SGGE~Sr~~LAl~~~~~~~--~~~p~~ifDEiDagi~G~~a~~v~~~l~~l------s~~~Qvi~ITH~pqv------Aa 494 (554) |-|-+-...|-|..|++.. .++..+-+||.-+|+++.+-..+|..|..+ -.+.|.|||||=-.- ++ T Consensus 1185 SAGQKvLAsliIRLALAEtf~snCgvLALDEPTTNLD~~niesLa~~L~~II~~rr~q~nfqLiVITHDE~fv~~i~~~~ 1264 (1294) T KOG0962 1185 SAGQKVLASLIIRLALAETFGSNCGVLALDEPTTNLDRENIESLAKALSRIIEERRRQRNFQLIVITHDEDFVQLLGRSA 1264 (1294) T ss_pred CCHHHHHHHHHHHHHHHHHHHHCCCCHHCCCCCCCCCHHHHHHHHHHHHHHHHHHHHCCCCCEEEEEHHHHHHHHHHHCC T ss_conf 11379999999999999987622442101687654576678999999999999986155731355421889999861222 Q ss_pred HCCCEEEEEEEEC Q ss_conf 0176179999621 Q gi|255764514|r 495 RADRHFLVYKTNK 507 (554) Q Consensus 495 ~a~~h~~v~K~~~ 507 (554) +.++-|.|.|... T Consensus 1265 ~~e~~yr~~kd~~ 1277 (1294) T KOG0962 1265 YPEYFYRVKKDES 1277 (1294) T ss_pred CCHHEEEECCCCH T ss_conf 5031232014610 No 424 >COG4674 Uncharacterized ABC-type transport system, ATPase component [General function prediction only] Probab=97.51 E-value=5.6e-05 Score=51.74 Aligned_cols=37 Identities=27% Similarity=0.549 Sum_probs=30.9 Q ss_pred EECCEEEEEEEEECCCC-EEEEECCCCCCHHHHHHHHH Q ss_conf 94227899998873898-18998899978889999999 Q gi|255764514|r 6 IYNIVLIESLDIDFSAG-LSILSGDTGSGKSILLDALI 42 (554) Q Consensus 6 i~Nf~~i~~~~i~f~~G-l~vItGetGaGKS~ildAl~ 42 (554) .-.|.-+.++++...|| +-+|+|||||||++++|+|+ T Consensus 15 F~GF~Aln~ls~~v~~Gelr~lIGpNGAGKTT~mD~It 52 (249) T COG4674 15 FGGFKALNDLSFSVDPGELRVLIGPNGAGKTTLMDVIT 52 (249) T ss_pred ECCEEEEEEEEEEECCCEEEEEECCCCCCCEEEEEEEC T ss_conf 76653420037886697289998789888505431001 No 425 >PRK10789 putative multidrug transporter membrane\ATP-binding components; Provisional Probab=97.51 E-value=7.4e-05 Score=50.96 Aligned_cols=121 Identities=22% Similarity=0.177 Sum_probs=51.4 Q ss_pred CCCCCEEEEECCCCCCCCHHHHHHCCHHHHHHHHHHHHHHCCCCC-CCEEEEECCCCC-CCHHHHHHHHHHHHHHHHCCC Q ss_conf 543200110127899831135440621579999999998436689-976998034468-887999999999999730593 Q gi|255764514|r 405 GIDRVEFYVQTNRGENPGPLMKLASGGELSRFLLALKIVLVDQGS-IPTLVFDEVDSG-IGGAVADAIGYRLKQLSKKIQ 482 (554) Q Consensus 405 G~d~v~f~~s~n~g~~~~pl~kiaSGGE~Sr~~LAl~~~~~~~~~-~p~~ifDEiDag-i~G~~a~~v~~~l~~ls~~~Q 482 (554) ..+++.|.+. ||+...=.+ .||.=|| +++.+..=+ ++| .....+|.+|-. ++= ..+-+.+.=..++.. T Consensus 330 vL~~isl~I~--~Ge~vaIVG--~SGsGKS-TLl~LL~g~--y~p~~G~I~idg~di~~i~~---~~lR~~I~~V~Q~~~ 399 (569) T PRK10789 330 ALENVNFTLK--PGQMLGICG--PTGSGKS-TLLSLIQRH--FDVSEGDIRFHDIPLTKLQL---DSWRSRLAVVSQTPF 399 (569) T ss_pred HHCCCCCEEC--CCCEEEEEC--CCCCCHH-HHHHHHHHH--HHCCCCCEEEECEECCCCCH---HHHHHCCCCCCCCCC T ss_conf 2307656888--997899879--9999879-999999977--64267874650101342576---888631476588750 Q ss_pred EEEEE---------------CHHHHHHHCCCEEEEEEEECCCCCCEEEEEEEECCHHHHH-HHHHHHHCC Q ss_conf 99980---------------8379865017617999962168752589999975988999-999998668 Q gi|255764514|r 483 LLAVT---------------HAPQVAARADRHFLVYKTNKPDDTQRIETYVAVLTPQERR-EEIARMLAG 536 (554) Q Consensus 483 vi~IT---------------H~pqvAa~a~~h~~v~K~~~~~~~~~~~~~i~~l~~~~r~-~Eiarml~g 536 (554) ++-=| ..-.++..|.-|=.|.+-..+-+|... ..=..|++-+|. --|||.+-- T Consensus 400 LF~~TI~eNI~lg~~~~~~eei~~a~~~a~l~~~i~~lp~G~dT~ig-e~G~~LSGGQrQRialARAll~ 468 (569) T PRK10789 400 LFSDTVANNIALGRPDATQQEIEHVARLASVHEDILRLPQGYDTEVG-ERGVMLSGGQKQRISIARALLL 468 (569) T ss_pred CCCCCHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCCCC-CCCCCCCHHHHHHHHHHHHHHC T ss_conf 25662999986579776545899999985556876437553237126-8889969999999999999954 No 426 >PRK10261 glutathione transporter ATP-binding protein; Provisional Probab=97.50 E-value=0.00076 Score=44.31 Aligned_cols=42 Identities=29% Similarity=0.479 Sum_probs=33.2 Q ss_pred EEEECCE-----------EEEEEEEECCCC-EEEEECCCCCCHHHHHHHHHHHH Q ss_conf 9994227-----------899998873898-18998899978889999999871 Q gi|255764514|r 4 LSIYNIV-----------LIESLDIDFSAG-LSILSGDTGSGKSILLDALILVT 45 (554) Q Consensus 4 L~i~Nf~-----------~i~~~~i~f~~G-l~vItGetGaGKS~ildAl~~~l 45 (554) |.|+|+. .+++++++..+| +.+|+||||||||++.-+|.=++ T Consensus 13 L~V~nLsv~f~~~~~~v~al~~VSf~v~~GE~vaLvGeSGSGKSTl~~~l~gll 66 (623) T PRK10261 13 LAVENLNIAFMQEQQKIAAVRNLSFSLQRGETLAIVGESGSGKSVTALALMRLL 66 (623) T ss_pred EEEECCEEEECCCCCCEEEEECCEEEECCCCEEEEECCCCCHHHHHHHHHHCCC T ss_conf 899462999818994189885617698899899999899978999999997798 No 427 >PRK11174 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Probab=97.49 E-value=0.00014 Score=49.16 Aligned_cols=48 Identities=13% Similarity=0.162 Sum_probs=25.7 Q ss_pred CCCCEEEEECCCCCCCCHHHHHHCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCC Q ss_conf 4320011012789983113544062157999999999843668997699803446 Q gi|255764514|r 406 IDRVEFYVQTNRGENPGPLMKLASGGELSRFLLALKIVLVDQGSIPTLVFDEVDS 460 (554) Q Consensus 406 ~d~v~f~~s~n~g~~~~pl~kiaSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDa 460 (554) .++|.|-+ +||+...=.+ .||.=||=+ +-+..-+ +.......+|-+|- T Consensus 366 L~~is~~i--~~Ge~vaIVG--~SGsGKSTl-~~LL~g~--~p~~G~I~i~g~di 413 (588) T PRK11174 366 AGPLNFTL--PAGQRVALVG--PSGAGKTSL-LNALLGF--LPYQGSLKINGIEL 413 (588) T ss_pred CCCEEEEE--CCCCEEEEEC--CCCCCHHHH-HHHHHHH--CCCCCEEEECCEEC T ss_conf 03646997--4997899989--998649999-9999872--89883899999860 No 428 >cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids. RLI's are not transport proteins, and thus cluster with a group of soluble proteins that lack the transmembrane components commonly found in other members of the family. Structurally, RLI's have an N-terminal Fe-S domain and two nucleotide-binding domains, which are arranged to form two composite active sites in their interface cleft. RLI is one of the most conserved enzymes between archaea and eukaryotes with a sequence identity more than 48%. The high degree of evolutionary conservation suggests that RLI performs a central role in archaeal and eukaryotic physiology. Probab=97.49 E-value=9.7e-05 Score=50.19 Aligned_cols=35 Identities=23% Similarity=0.321 Sum_probs=28.8 Q ss_pred CCEEEEEEEEECCCC-EEEEECCCCCCHHHHHHHHHH Q ss_conf 227899998873898-189988999788899999998 Q gi|255764514|r 8 NIVLIESLDIDFSAG-LSILSGDTGSGKSILLDALIL 43 (554) Q Consensus 8 Nf~~i~~~~i~f~~G-l~vItGetGaGKS~ildAl~~ 43 (554) +|.+.+++. ++.+| +.+|.||||||||+++..|.- T Consensus 12 ~~~~l~~~~-~v~~GEiv~ilGpNGaGKSTllk~i~G 47 (177) T cd03222 12 VFFLLVELG-VVKEGEVIGIVGPNGTGKTTAVKILAG 47 (177) T ss_pred CEEEECCCC-CCCCCCEEEEECCCCCCHHHHHHHHHC T ss_conf 989865899-558998999989999999999999968 No 429 >PRK00635 excinuclease ABC subunit A; Provisional Probab=97.48 E-value=0.00097 Score=43.61 Aligned_cols=75 Identities=15% Similarity=0.131 Sum_probs=57.7 Q ss_pred HHCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHH-CCCEEEEECHHHHHHHCCCEEEE Q ss_conf 40621579999999998436689976998034468887999999999999730-59399980837986501761799 Q gi|255764514|r 427 LASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSK-KIQLLAVTHAPQVAARADRHFLV 502 (554) Q Consensus 427 iaSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~-~~Qvi~ITH~pqvAa~a~~h~~v 502 (554) .+||||.=|+-||-.+.-.. ...-.|||||.-+|+-=.-..++-..|.+|-. -+=||||-|-+.|.+.||+=+=+ T Consensus 1699 TLSGGEaQRiKLa~eL~~~~-~~~tLyilDEPTtGLH~~Di~~Ll~~l~~Lvd~G~TvivIEHnldvi~~AD~iIDl 1774 (1809) T PRK00635 1699 SLSLSEKIAIKIAKFLYLPP-KHPTLFLLDEIATSLDNQKKSQLLEQLRTLVSLGHSVIYIDHDVALLKQADYLIEM 1774 (1809) T ss_pred CCCHHHHHHHHHHHHHCCCC-CCCEEEEECCCCCCCCHHHHHHHHHHHHHHHHCCCEEEEEECCHHHHHHCCEEEEC T ss_conf 65559999999999857668-89969997388778899999999999999986899799993788899639999976 No 430 >COG0396 sufC Cysteine desulfurase activator ATPase [Posttranslational modification, protein turnover, chaperones] Probab=97.48 E-value=0.00013 Score=49.34 Aligned_cols=39 Identities=26% Similarity=0.518 Sum_probs=29.9 Q ss_pred EEEEECC--------EEEEEEEEECCCC-EEEEECCCCCCHHHHHHHH Q ss_conf 5999422--------7899998873898-1899889997888999999 Q gi|255764514|r 3 RLSIYNI--------VLIESLDIDFSAG-LSILSGDTGSGKSILLDAL 41 (554) Q Consensus 3 ~L~i~Nf--------~~i~~~~i~f~~G-l~vItGetGaGKS~ildAl 41 (554) -|.|+|. .+++.+++.+.+| +.+|-||||||||+|--+| T Consensus 3 ~L~I~dLhv~v~~~keILkgvnL~v~~GEvhaiMGPNGsGKSTLa~~i 50 (251) T COG0396 3 MLEIKDLHVEVEGKKEILKGVNLTVKEGEVHAIMGPNGSGKSTLAYTI 50 (251) T ss_pred EEEEEEEEEEECCCHHHHCCCCEEECCCCEEEEECCCCCCHHHHHHHH T ss_conf 379954699956852100374146759828999889987889999997 No 431 >PRK11022 dppD dipeptide transporter ATP-binding subunit; Provisional Probab=97.47 E-value=0.0002 Score=48.18 Aligned_cols=35 Identities=23% Similarity=0.413 Sum_probs=29.6 Q ss_pred EEEEEEEECCCC-EEEEECCCCCCHHHHHHHHHHHH Q ss_conf 899998873898-18998899978889999999871 Q gi|255764514|r 11 LIESLDIDFSAG-LSILSGDTGSGKSILLDALILVT 45 (554) Q Consensus 11 ~i~~~~i~f~~G-l~vItGetGaGKS~ildAl~~~l 45 (554) .++++++++.+| +..|+||||||||+++-+|.-++ T Consensus 22 Av~~Vsf~i~~GEilgivGeSGsGKSTl~~~ilgll 57 (327) T PRK11022 22 AVDRISYSVKQGEVVGIVGESGSGKSVSSLAIMGLI 57 (327) T ss_pred EEECEEEEECCCCEEEEECCCCCHHHHHHHHHHCCC T ss_conf 984418798899999999999878999999997488 No 432 >COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] Probab=97.46 E-value=0.00013 Score=49.42 Aligned_cols=73 Identities=26% Similarity=0.347 Sum_probs=56.9 Q ss_pred HCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCC-CEEEEECHHHHHHH-CCCEEEEEE Q ss_conf 062157999999999843668997699803446888799999999999973059-39998083798650-176179999 Q gi|255764514|r 428 ASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSKKI-QLLAVTHAPQVAAR-ADRHFLVYK 504 (554) Q Consensus 428 aSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~~~-Qvi~ITH~pqvAa~-a~~h~~v~K 504 (554) +|||-+=|++.|=. ++. ....+.|||+-+.++-+...-|-..++.|++.. -.+||||--.-|.. ||+-+.... T Consensus 137 LSGGQqQRVAIARA--LaM--~P~vmLFDEPTSALDPElv~EVL~vm~~LA~eGmTMivVTHEM~FAr~VadrviFmd~ 211 (240) T COG1126 137 LSGGQQQRVAIARA--LAM--DPKVMLFDEPTSALDPELVGEVLDVMKDLAEEGMTMIIVTHEMGFAREVADRVIFMDQ 211 (240) T ss_pred CCCHHHHHHHHHHH--HCC--CCCEEEECCCCCCCCHHHHHHHHHHHHHHHHCCCEEEEEECHHHHHHHHHHEEEEEEC T ss_conf 48078899999998--717--9988863697543798899999999999997698699995036799986222899528 No 433 >PRK09452 potA putrescine/spermidine ABC transporter ATPase protein; Reviewed Probab=97.46 E-value=0.0014 Score=42.58 Aligned_cols=96 Identities=27% Similarity=0.382 Sum_probs=68.2 Q ss_pred HCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHH--CCCEEEEECHHHHHHH-CCCEEEEEE Q ss_conf 0621579999999998436689976998034468887999999999999730--5939998083798650-176179999 Q gi|255764514|r 428 ASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSK--KIQLLAVTHAPQVAAR-ADRHFLVYK 504 (554) Q Consensus 428 aSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~--~~Qvi~ITH~pqvAa~-a~~h~~v~K 504 (554) +|||++=|++||-.++ .....++|||-=++++-..-..+-..|++|-+ ..=+|.|||-...|.. ||+ +.|-+ T Consensus 148 LSGGqqQRVaiARAL~----~~P~vLLLDEPts~LD~~~r~~~~~~l~~l~~~~g~T~i~VTHD~~eA~~laDr-I~VM~ 222 (378) T PRK09452 148 LSGGQQQRVAIARAVV----NKPKVLLLDESLSALDYKLRKQMQNELKALQRKLGITFVFVTHDQEEALTMSDR-IVVMR 222 (378) T ss_pred CCHHHHHHHHHHHHHC----CCCCEEEECCCCCCCCHHHHHHHHHHHHHHHHHHCCEEEEECCCHHHHHHHCCE-EEEEE T ss_conf 9988999999999862----399899957864447999999999999999998499899998899999986998-99998 Q ss_pred EECCCCCCEEEEEEEEC-CHHH-----HHHHHHHHHCCCC Q ss_conf 62168752589999975-9889-----9999999866880 Q gi|255764514|r 505 TNKPDDTQRIETYVAVL-TPQE-----RREEIARMLAGSH 538 (554) Q Consensus 505 ~~~~~~~~~~~~~i~~l-~~~~-----r~~Eiarml~g~~ 538 (554) . | .|... +++| +-.-+|+.+|-.+ T Consensus 223 ~---G-------~I~q~GtP~eiy~~P~~~fvA~fiG~~N 252 (378) T PRK09452 223 D---G-------RIEQDGTPREIYEEPKNLFVARFIGEIN 252 (378) T ss_pred C---C-------EEEEEECHHHHHHCCCCHHHHHHCCCCE T ss_conf 9---9-------8999948899986899858986378561 No 434 >PRK10790 putative multidrug transporter membrane\ATP-binding components; Provisional Probab=97.44 E-value=0.0001 Score=50.04 Aligned_cols=118 Identities=13% Similarity=0.062 Sum_probs=50.1 Q ss_pred CCCCEEEEECCCCCCCCHHHHHHCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCC-CCHHHHH---------------H Q ss_conf 43200110127899831135440621579999999998436689976998034468-8879999---------------9 Q gi|255764514|r 406 IDRVEFYVQTNRGENPGPLMKLASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSG-IGGAVAD---------------A 469 (554) Q Consensus 406 ~d~v~f~~s~n~g~~~~pl~kiaSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDag-i~G~~a~---------------~ 469 (554) .++|.|-+ +||+...=.+ .||.=|| +++.+..-+... ......+|-+|-. ++-..-. . T Consensus 357 L~~is~~I--~~Ge~vaIVG--~SGsGKS-TL~~LL~rly~p-~~G~I~idG~di~~i~~~~lR~~i~~V~Q~~~LF~gT 430 (593) T PRK10790 357 LKNINLSV--PSRNFVALVG--HTGSGKS-TLASLLMGYYPL-TEGEIRLDGRPLSSLSHSVLRQGVAMVQQDPVVLADT 430 (593) T ss_pred HHCCCCCC--CCCCEEEEEC--CCCCCHH-HHHHHHHHHCCC-CCCCCCCCCEECCCCCHHHHHHCCCCCCCCCCCCCCC T ss_conf 42601044--8997899879--9988689-999999985567-8994165993244246888863157516665145652 Q ss_pred HHHHHHHHHHCCCEEEEEC--HHHHHHHCCCEEEEEEEECCCCCCEEEEEEEECCHHHHH-HHHHHHHCC Q ss_conf 9999999730593999808--379865017617999962168752589999975988999-999998668 Q gi|255764514|r 470 IGYRLKQLSKKIQLLAVTH--APQVAARADRHFLVYKTNKPDDTQRIETYVAVLTPQERR-EEIARMLAG 536 (554) Q Consensus 470 v~~~l~~ls~~~Qvi~ITH--~pqvAa~a~~h~~v~K~~~~~~~~~~~~~i~~l~~~~r~-~Eiarml~g 536 (554) |.+=+. ++++ +|. .-++|..|.-|=.|.+-..+-+|.. -..=..|++-+|. --|||.+-. T Consensus 431 I~eNi~-~g~~-----~~~~~i~~a~~~a~l~~~i~~lp~G~dT~v-ge~G~~LSgGQrQRiaiARall~ 493 (593) T PRK10790 431 FLANVT-LGRD-----ISEEQVWQALETVQLAELARSLSDGLYTPL-GEQGNTLSVGQKQLLALARVLVE 493 (593) T ss_pred HHHHHH-HHCC-----CCHHHHHHHHHHHHHHHHHHHCCCHHCCHH-CCCCCCCCHHHHHHHHHHHHHHC T ss_conf 999977-6002-----367999999999778999985742010442-38768879999999999999955 No 435 >PRK11176 lipid transporter ATP-binding/permease protein; Provisional Probab=97.43 E-value=8.9e-05 Score=50.43 Aligned_cols=48 Identities=17% Similarity=0.200 Sum_probs=26.6 Q ss_pred CCCCEEEEECCCCCCCCHHHHHHCCHHHHHHHHHHHHHHCCCCC-CCEEEEECCCC Q ss_conf 43200110127899831135440621579999999998436689-97699803446 Q gi|255764514|r 406 IDRVEFYVQTNRGENPGPLMKLASGGELSRFLLALKIVLVDQGS-IPTLVFDEVDS 460 (554) Q Consensus 406 ~d~v~f~~s~n~g~~~~pl~kiaSGGE~Sr~~LAl~~~~~~~~~-~p~~ifDEiDa 460 (554) .++|.|-+. ||+...=.+ .||.=|| +++.+..-+ ++| .....+|.+|- T Consensus 358 L~~isl~I~--~G~~vaiVG--~SGsGKS-TL~~LL~gl--y~p~~G~I~idg~di 406 (581) T PRK11176 358 LRNINFKIP--AGKTVALVG--RSGSGKS-TIANLLTRF--YDIDEGEILLDGHDL 406 (581) T ss_pred CCCCCCCCC--CCCEEECCC--CCCCCHH-HHHHHHHHH--CCCCCCEEEECCEEH T ss_conf 106633579--994431228--9998678-999999853--667887487898851 No 436 >cd03294 ABC_Pro_Gly_Bertaine This family comprises the glycine betaine/L-proline ATP binding subunit in bacteria and its equivalents in archaea. This transport system belong to the larger ATP-Binding Cassette (ABC) transporter superfamily. The characteristic feature of these transporters is the obligatory coupling of ATP hydrolysis to substrate translocation. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins. Probab=97.43 E-value=0.00015 Score=49.01 Aligned_cols=37 Identities=30% Similarity=0.498 Sum_probs=30.4 Q ss_pred CEEEEEEEEECCCC-EEEEECCCCCCHHHHHHHHHHHH Q ss_conf 27899998873898-18998899978889999999871 Q gi|255764514|r 9 IVLIESLDIDFSAG-LSILSGDTGSGKSILLDALILVT 45 (554) Q Consensus 9 f~~i~~~~i~f~~G-l~vItGetGaGKS~ildAl~~~l 45 (554) +..+++++++..+| +.+|.||+|||||+++.+|.-+. T Consensus 37 ~~aL~~vsl~i~~GE~~~ivG~SGsGKSTLLr~i~GL~ 74 (269) T cd03294 37 TVGVNDVSLDVREGEIFVIMGLSGSGKSTLLRCINRLI 74 (269) T ss_pred EEEECCCEEEECCCCEEEEECCCCCHHHHHHHHHHCCC T ss_conf 27977747588899999999899848999999997599 No 437 >PRK11153 metN DL-methionine transporter ATP-binding subunit; Provisional Probab=97.43 E-value=0.00022 Score=47.89 Aligned_cols=73 Identities=26% Similarity=0.334 Sum_probs=60.1 Q ss_pred HCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHH--CCCEEEEECHHHHHHHCCCEEEEEE Q ss_conf 0621579999999998436689976998034468887999999999999730--5939998083798650176179999 Q gi|255764514|r 428 ASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSK--KIQLLAVTHAPQVAARADRHFLVYK 504 (554) Q Consensus 428 aSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~--~~Qvi~ITH~pqvAa~a~~h~~v~K 504 (554) +|||++=|+++|..++ ..+..+++||.=+|++-.+...|-++|+++.+ ..=||.|||--.++..--.+..|-. T Consensus 141 LSGGqkQRV~IArALa----~~P~iLl~DEPTsaLDp~t~~~Il~lL~~l~~e~g~TivlITHdm~~v~~icdrVaVm~ 215 (343) T PRK11153 141 LSGGQKQRVAIARALA----SNPKVLLCDEATSALDPATTRSILELLKDINRRLGLTILLITHEMDVVKRICDCVAVIS 215 (343) T ss_pred CCHHHHHHHHHHHHHH----CCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHHCCEEEEECCCHHHHHHHCCEEEEEE T ss_conf 8999999999999986----69999999288765899999999999999999619899998889999998699999998 No 438 >COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] Probab=97.41 E-value=0.00033 Score=46.71 Aligned_cols=37 Identities=24% Similarity=0.513 Sum_probs=31.7 Q ss_pred CEEEEEEEEECCCC-EEEEECCCCCCHHHHHHHHHHHH Q ss_conf 27899998873898-18998899978889999999871 Q gi|255764514|r 9 IVLIESLDIDFSAG-LSILSGDTGSGKSILLDALILVT 45 (554) Q Consensus 9 f~~i~~~~i~f~~G-l~vItGetGaGKS~ildAl~~~l 45 (554) +..+++++++..+| |.+|.||+|+|||++|..|.-+. T Consensus 16 ~~vl~~i~L~v~~GEfvsilGpSGcGKSTLLriiAGL~ 53 (248) T COG1116 16 VEVLEDINLSVEKGEFVAILGPSGCGKSTLLRLIAGLE 53 (248) T ss_pred EEEECCCEEEECCCCEEEEECCCCCCHHHHHHHHHCCC T ss_conf 68760503587799799998999788999999996878 No 439 >TIGR01188 drrA daunorubicin resistance ABC transporter, ATP-binding protein; InterPro: IPR005894 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems. ABC transporters are minimally constituted of two conserved regions: a highly conserved ATP binding cassette (ABC) and a less conserved transmembrane domain (TMD). These regions can be found on the same protein or on two different ones. Most ABC transporters function as a dimer and therefore are constituted of four domains, two ABC modules and two TMDs. ABC transporters are involved in the export or import of a wide variety of substrates ranging from small ions to macromolecules. The major function of ABC import systems is to provide essential nutrients to bacteria. They are found only in prokaryotes and their four constitutive domains are usually encoded by independent polypeptides (two ABC proteins and two TMD proteins). Prokaryotic importers require additional extracytoplasmic binding proteins (one or more per systems) for function. In contrast, export systems are involved in the extrusion of noxious substances, the export of extracellular toxins and the targeting of membrane components. They are found in all living organisms and in general the TMD is fused to the ABC module in a variety of combinations. Some eukaryotic exporters encode the four domains on the same polypeptide chain . The ABC module (approximately two hundred amino acid residues) is known to bind and hydrolyze ATP, thereby coupling transport to ATP hydrolysis in a large number of biological processes. The cassette is duplicated in several subfamilies. Its primary sequence is highly conserved, displaying a typical phosphate-binding loop: Walker A, and a magnesium binding site: Walker B. Besides these two regions, three other conserved motifs are present in the ABC cassette: the switch region which contains a histidine loop, postulated to polarize the attaching water molecule for hydrolysis, the signature conserved motif (LSGGQ) specific to the ABC transporter, and the Q-motif (between Walker A and the signature), which interacts with the gamma phosphate through a water bond. The Walker A, Walker B, Q-loop and switch region form the nucleotide binding site , , . The 3D structure of a monomeric ABC module adopts a stubby L-shape with two distinct arms. ArmI (mainly beta-strand) contains Walker A and Walker B. The important residues for ATP hydrolysis and/or binding are located in the P-loop. The ATP-binding pocket is located at the extremity of armI. The perpendicular armII contains mostly the alpha helical subdomain with the signature motif. It only seems to be required for structural integrity of the ABC module. ArmII is in direct contact with the TMD. The hinge between armI and armII contains both the histidine loop and the Q-loop, making contact with the gamma phosphate of the ATP molecule. ATP hydrolysis leads to a conformational change that could facilitate ADP release. In the dimer the two ABC cassettes contact each other through hydrophobic interactions at the antiparallel beta-sheet of armI by a two-fold axis , , , , , . Proteins known to belong to this family are classified in several functional subfamilies depending on the substrate used (for further information see http://www.tcdb.org/tcdb/index.php?tc=3.A.1). This family contains the daunorubicin resistance ABC transporter, ATP binding subunit in bacteria and archaea. This model is restricted in its scope to preferentially recognize the ATP binding subunit associated with effux of the drug, daunorubicin. In other words it functions as an ATP dependent antiporter. . Probab=97.41 E-value=0.00012 Score=49.60 Aligned_cols=69 Identities=14% Similarity=0.301 Sum_probs=47.8 Q ss_pred CCEEEEEEEEECCCC-EEEEECCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCEEEEEEEEECCCCHHHHHHHHHCCCCC Q ss_conf 227899998873898-1899889997888999999987147325331128972589999997289737888887478988 Q gi|255764514|r 8 NIVLIESLDIDFSAG-LSILSGDTGSGKSILLDALILVTGGRGDGGLVRRHAEKGQVVAVFEISHLPALEILFAEANLTL 86 (554) Q Consensus 8 Nf~~i~~~~i~f~~G-l~vItGetGaGKS~ildAl~~~lG~r~~~~~Ir~g~~~a~Ve~~F~~~~~~~~~~~~~~~~~~~ 86 (554) +|.-+|.+++.-..| ...|=||||||||+++.=|+=+| ||.+-.|.|-+ +|+-..| T Consensus 7 ~f~AVdgv~f~V~~G~vfGfLGPNGAGKTTti~mLtTll---------~P~sG~A~V~G-YDvvreP------------- 63 (343) T TIGR01188 7 DFKAVDGVNFKVREGEVFGFLGPNGAGKTTTIRMLTTLL---------KPTSGTARVAG-YDVVREP------------- 63 (343) T ss_pred CEEEECCCCCEECCCEEEEEECCCCCCHHHHHHHHCCCC---------CCCCCEEEEEE-EECCCCH------------- T ss_conf 635612542053062489976879985133563410255---------79987689983-2102363------------- Q ss_pred CCCEEEEEEEECCC Q ss_conf 88389999994389 Q gi|255764514|r 87 EKHVILRRVQFPDG 100 (554) Q Consensus 87 ~~~~iirR~i~~~G 100 (554) ..+-+||.|.--| T Consensus 64 -~kl~VRr~IG~v~ 76 (343) T TIGR01188 64 -RKLKVRRRIGIVP 76 (343) T ss_pred -HHCCCCEEEEEEC T ss_conf -0403211320446 No 440 >TIGR03265 PhnT2 putative 2-aminoethylphosphonate ABC transport system, ATP-binding protein component. This ABC transporter ATP-binding protein is found in a number of genomes in operon-like contexts strongly suggesting a substrate specificity for 2-aminoethylphosphonate (2-AEP). The characterized PhnSTUV system is absent in the genomes in which this system is found. These genomes encode systems for the catabolism of 2-AEP, making the need for a 2-AEP-specific transporter likely. Probab=97.40 E-value=0.00021 Score=47.93 Aligned_cols=37 Identities=22% Similarity=0.451 Sum_probs=31.0 Q ss_pred CCEEEEEEEEECCCC-EEEEECCCCCCHHHHHHHHHHH Q ss_conf 227899998873898-1899889997888999999987 Q gi|255764514|r 8 NIVLIESLDIDFSAG-LSILSGDTGSGKSILLDALILV 44 (554) Q Consensus 8 Nf~~i~~~~i~f~~G-l~vItGetGaGKS~ildAl~~~ 44 (554) ++..+++++++..+| +.+|.||+|||||++|.+|.-+ T Consensus 16 ~~~al~~v~l~v~~Ge~~~llGpSG~GKtTlLr~iaGl 53 (353) T TIGR03265 16 AFTALKDISLSVKKGEFVCLLGPSGCGKTTLLRIIAGL 53 (353) T ss_pred CEEEECCCEEEECCCCEEEEECCCCCHHHHHHHHHHCC T ss_conf 99888664869989999999999953599999999769 No 441 >PRK11432 fbpC ferric transporter ATP-binding subunit; Provisional Probab=97.40 E-value=0.0002 Score=48.12 Aligned_cols=34 Identities=29% Similarity=0.577 Sum_probs=29.3 Q ss_pred CEEEEEEEEECCCC-EEEEECCCCCCHHHHHHHHH Q ss_conf 27899998873898-18998899978889999999 Q gi|255764514|r 9 IVLIESLDIDFSAG-LSILSGDTGSGKSILLDALI 42 (554) Q Consensus 9 f~~i~~~~i~f~~G-l~vItGetGaGKS~ildAl~ 42 (554) +..+++++++..+| |.+|.||+|||||+++.+|. T Consensus 19 ~~al~~vsl~i~~Ge~~~llGpSG~GKTTlLr~ia 53 (351) T PRK11432 19 NTVIDNLDLTIKQGTMVTLLGPSGCGKTTVLRLVA 53 (351) T ss_pred EEEECCCEEEECCCCEEEEECCCCCHHHHHHHHHH T ss_conf 48984457498899899999999649999999997 No 442 >TIGR03258 PhnT 2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT. This ATP-binding component of an ABC transport system is found in Salmonella and Burkholderia lineages in the vicinity of enzymes for the breakdown of 2-aminoethylphosphonate. Probab=97.40 E-value=0.00021 Score=47.94 Aligned_cols=37 Identities=32% Similarity=0.559 Sum_probs=30.5 Q ss_pred CCEEEEEEEEECCCC-EEEEECCCCCCHHHHHHHHHHH Q ss_conf 227899998873898-1899889997888999999987 Q gi|255764514|r 8 NIVLIESLDIDFSAG-LSILSGDTGSGKSILLDALILV 44 (554) Q Consensus 8 Nf~~i~~~~i~f~~G-l~vItGetGaGKS~ildAl~~~ 44 (554) ++..+++++++..+| |.+|.||+|||||++|..|.-+ T Consensus 17 ~~~al~dvsl~i~~GE~~~llGpSG~GKTTlLr~iaGL 54 (362) T TIGR03258 17 ANTVLDDLSLEIEAGELLALIGKSGCGKTTLLRAIAGF 54 (362) T ss_pred CEEEECCCEEEECCCCEEEEECCCCCHHHHHHHHHHCC T ss_conf 98899376719999989999999974599999999777 No 443 >cd03258 ABC_MetN_methionine_transporter MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport. Other members of this system include the MetP permease and the MetQ substrate binding protein. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins. Probab=97.39 E-value=0.00019 Score=48.29 Aligned_cols=37 Identities=19% Similarity=0.419 Sum_probs=30.2 Q ss_pred CEEEEEEEEECCCC-EEEEECCCCCCHHHHHHHHHHHH Q ss_conf 27899998873898-18998899978889999999871 Q gi|255764514|r 9 IVLIESLDIDFSAG-LSILSGDTGSGKSILLDALILVT 45 (554) Q Consensus 9 f~~i~~~~i~f~~G-l~vItGetGaGKS~ildAl~~~l 45 (554) +..+++++++..+| +.+|+||+|||||+++..|..+. T Consensus 18 ~~al~~vsl~i~~Ge~~~ivG~SGsGKSTllr~i~gL~ 55 (233) T cd03258 18 VTALKDVSLSVPKGEIFGIIGRSGAGKSTLIRCINGLE 55 (233) T ss_pred EEEEECCEEEECCCCEEEEECCCCCHHHHHHHHHHCCC T ss_conf 99984828899999999998898058999999996799 No 444 >TIGR01166 cbiO cobalt ABC transporter, ATP-binding protein; InterPro: IPR005876 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems. ABC transporters are minimally constituted of two conserved regions: a highly conserved ATP binding cassette (ABC) and a less conserved transmembrane domain (TMD). These regions can be found on the same protein or on two different ones. Most ABC transporters function as a dimer and therefore are constituted of four domains, two ABC modules and two TMDs. ABC transporters are involved in the export or import of a wide variety of substrates ranging from small ions to macromolecules. The major function of ABC import systems is to provide essential nutrients to bacteria. They are found only in prokaryotes and their four constitutive domains are usually encoded by independent polypeptides (two ABC proteins and two TMD proteins). Prokaryotic importers require additional extracytoplasmic binding proteins (one or more per systems) for function. In contrast, export systems are involved in the extrusion of noxious substances, the export of extracellular toxins and the targeting of membrane components. They are found in all living organisms and in general the TMD is fused to the ABC module in a variety of combinations. Some eukaryotic exporters encode the four domains on the same polypeptide chain . The ABC module (approximately two hundred amino acid residues) is known to bind and hydrolyze ATP, thereby coupling transport to ATP hydrolysis in a large number of biological processes. The cassette is duplicated in several subfamilies. Its primary sequence is highly conserved, displaying a typical phosphate-binding loop: Walker A, and a magnesium binding site: Walker B. Besides these two regions, three other conserved motifs are present in the ABC cassette: the switch region which contains a histidine loop, postulated to polarize the attaching water molecule for hydrolysis, the signature conserved motif (LSGGQ) specific to the ABC transporter, and the Q-motif (between Walker A and the signature), which interacts with the gamma phosphate through a water bond. The Walker A, Walker B, Q-loop and switch region form the nucleotide binding site , , . The 3D structure of a monomeric ABC module adopts a stubby L-shape with two distinct arms. ArmI (mainly beta-strand) contains Walker A and Walker B. The important residues for ATP hydrolysis and/or binding are located in the P-loop. The ATP-binding pocket is located at the extremity of armI. The perpendicular armII contains mostly the alpha helical subdomain with the signature motif. It only seems to be required for structural integrity of the ABC module. ArmII is in direct contact with the TMD. The hinge between armI and armII contains both the histidine loop and the Q-loop, making contact with the gamma phosphate of the ATP molecule. ATP hydrolysis leads to a conformational change that could facilitate ADP release. In the dimer the two ABC cassettes contact each other through hydrophobic interactions at the antiparallel beta-sheet of armI by a two-fold axis , , , , , . Proteins known to belong to this family are classified in several functional subfamilies depending on the substrate used (for further information see http://www.tcdb.org/tcdb/index.php?tc=3.A.1). This entry represents the ATP binding subunit of the multisubunit cobalt transporter in bacteria and its equivalents in archaea. This superfamily includes two groups, one which catalyses the uptake of small molecules, including ions from the external milieu and the other group which is engaged in the efflux of small molecular weight compounds and ions from within the cell. Energy derived from the hydrolysis of ATP drives both the process of uptake and efflux.; GO: 0006824 cobalt ion transport, 0009276 1-2nm peptidoglycan-based cell wall. Probab=97.39 E-value=0.00065 Score=44.73 Aligned_cols=65 Identities=28% Similarity=0.314 Sum_probs=45.1 Q ss_pred CCCCHHHHHHCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCC-CEEEEEC Q ss_conf 983113544062157999999999843668997699803446888799999999999973059-3999808 Q gi|255764514|r 419 ENPGPLMKLASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSKKI-QLLAVTH 488 (554) Q Consensus 419 ~~~~pl~kiaSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~~~-Qvi~ITH 488 (554) -.-+|.+ .+||||+=|++.| -|++. .+..||+||-=||+++.=...+...|+.|-..- -||+=|| T Consensus 120 ~~~rp~h-~LS~GekkRvAIA--GAvAM--~Pd~l~LDEPTAGLDp~G~~q~~~~l~~L~~~G~tvv~STH 185 (190) T TIGR01166 120 LEERPTH-LLSGGEKKRVAIA--GAVAM--RPDVLLLDEPTAGLDPAGAEQLLAILRRLRAEGTTVVISTH 185 (190) T ss_pred HHHCCHH-HCCCCCHHHHHHH--HHHHH--CCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCEEEEEEC T ss_conf 4412241-1558613577777--58861--66346642788897874799999998878723998999725 No 445 >COG4988 CydD ABC-type transport system involved in cytochrome bd biosynthesis, ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Probab=97.39 E-value=0.00016 Score=48.80 Aligned_cols=68 Identities=21% Similarity=0.185 Sum_probs=34.2 Q ss_pred EEECCCCCCCCHHHHHHCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCEEEEECHHH Q ss_conf 10127899831135440621579999999998436689976998034468887999999999999730593999808379 Q gi|255764514|r 412 YVQTNRGENPGPLMKLASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSKKIQLLAVTHAPQ 491 (554) Q Consensus 412 ~~s~n~g~~~~pl~kiaSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~~~Qvi~ITH~pq 491 (554) -++.+||+.-.-+ -.||-=|| +++.+..-+.. .....+.++.+|. .-+..-+-..|+--|+|.|. T Consensus 341 ~~t~~~g~~talv--G~SGaGKS-TLl~lL~G~~~-~~~G~I~vng~~l-----------~~l~~~~~~k~i~~v~Q~p~ 405 (559) T COG4988 341 NLTIKAGQLTALV--GASGAGKS-TLLNLLLGFLA-PTQGEIRVNGIDL-----------RDLSPEAWRKQISWVSQNPY 405 (559) T ss_pred EEEECCCCEEEEE--CCCCCCHH-HHHHHHHCCCC-CCCCEEEECCCCC-----------CCCCHHHHHHHEEEECCCCC T ss_conf 0675489679998--89999789-99999847577-7784488899310-----------00687788867246279984 Q ss_pred HHH Q ss_conf 865 Q gi|255764514|r 492 VAA 494 (554) Q Consensus 492 vAa 494 (554) +=+ T Consensus 406 lf~ 408 (559) T COG4988 406 LFA 408 (559) T ss_pred CCC T ss_conf 056 No 446 >TIGR03415 ABC_choXWV_ATP choline ABC transporter, ATP-binding protein. Members of this protein family are the ATP-binding subunit of a three-protein transporter. This family belongs, more broadly, to the family of proline and glycine-betaine transporters, but members have been identified by direct characterization and by bioinformatic means as choline transporters. Many species have several closely-related members of this family, probably with variable abilities to act additionally on related quaternary amines. Probab=97.37 E-value=0.00024 Score=47.55 Aligned_cols=36 Identities=36% Similarity=0.522 Sum_probs=30.3 Q ss_pred EEEEEEEEECCCC-EEEEECCCCCCHHHHHHHHHHHH Q ss_conf 7899998873898-18998899978889999999871 Q gi|255764514|r 10 VLIESLDIDFSAG-LSILSGDTGSGKSILLDALILVT 45 (554) Q Consensus 10 ~~i~~~~i~f~~G-l~vItGetGaGKS~ildAl~~~l 45 (554) .-.++++++..+| +.+|.||+|||||+++.+|.-+. T Consensus 38 vAV~dvsl~I~~GEi~~lvGpSGsGKSTLLr~i~GL~ 74 (382) T TIGR03415 38 VGVANASLDIEEGEICVLMGLSGSGKSSLLRAVNGLN 74 (382) T ss_pred EEEECCEEEECCCCEEEEECCCCCHHHHHHHHHHCCC T ss_conf 9896517488799899999999734999999997599 No 447 >COG1117 PstB ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism] Probab=97.36 E-value=0.00027 Score=47.26 Aligned_cols=67 Identities=30% Similarity=0.364 Sum_probs=56.2 Q ss_pred HCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCEEEEECHHHHHHHCCC Q ss_conf 06215799999999984366899769980344688879999999999997305939998083798650176 Q gi|255764514|r 428 ASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSKKIQLLAVTHAPQVAARADR 498 (554) Q Consensus 428 aSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~~~Qvi~ITH~pqvAa~a~~ 498 (554) +|||..-|+-+|=..+. .+..+.+||.-+.++--...++-+++.+|.++.-|+.|||.+|=||+-.. T Consensus 150 LSGGQQQRLcIARalAv----~PeVlLmDEPtSALDPIsT~kIEeLi~eLk~~yTIviVTHnmqQAaRvSD 216 (253) T COG1117 150 LSGGQQQRLCIARALAV----KPEVLLMDEPTSALDPISTLKIEELITELKKKYTIVIVTHNMQQAARVSD 216 (253) T ss_pred CCHHHHHHHHHHHHHHC----CCCEEEECCCCCCCCCHHHHHHHHHHHHHHHCCEEEEEECCHHHHHHHHH T ss_conf 87346789999998726----98678744864224813588999999998746489999379999878777 No 448 >COG4619 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Probab=97.34 E-value=0.00028 Score=47.13 Aligned_cols=36 Identities=25% Similarity=0.559 Sum_probs=27.1 Q ss_pred EEEEEEEECCCC-EEEEECCCCCCHHHHHHHHHHHHC Q ss_conf 899998873898-189988999788899999998714 Q gi|255764514|r 11 LIESLDIDFSAG-LSILSGDTGSGKSILLDALILVTG 46 (554) Q Consensus 11 ~i~~~~i~f~~G-l~vItGetGaGKS~ildAl~~~lG 46 (554) +.+.+++...+| +-+||||+|+|||+++.+++.+-- T Consensus 18 il~~isl~v~~Ge~iaitGPSG~GKStllk~va~Lis 54 (223) T COG4619 18 ILNNISLSVRAGEFIAITGPSGCGKSTLLKIVASLIS 54 (223) T ss_pred EECCEEEEECCCCEEEEECCCCCCHHHHHHHHHHCCC T ss_conf 4324136653885488767887668899999981369 No 449 >PRK10070 glycine betaine transporter ATP-binding subunit; Provisional Probab=97.34 E-value=0.00027 Score=47.26 Aligned_cols=36 Identities=22% Similarity=0.408 Sum_probs=29.9 Q ss_pred EEEEEEEEECCCC-EEEEECCCCCCHHHHHHHHHHHH Q ss_conf 7899998873898-18998899978889999999871 Q gi|255764514|r 10 VLIESLDIDFSAG-LSILSGDTGSGKSILLDALILVT 45 (554) Q Consensus 10 ~~i~~~~i~f~~G-l~vItGetGaGKS~ildAl~~~l 45 (554) .-.++++++..+| +.+|.||+|||||+++..|.-+. T Consensus 42 vAv~dVsl~I~~GEi~~ivG~SGsGKSTLlr~i~gL~ 78 (400) T PRK10070 42 LGVKDASLAIEEGEIFVIMGLSGSGKSTMVRLLNRLI 78 (400) T ss_pred EEEECCEEEECCCCEEEEECCCCCHHHHHHHHHHCCC T ss_conf 9897407688799999999999846999999997599 No 450 >PRK10419 nikE nickel transporter ATP-binding protein; Provisional Probab=97.34 E-value=0.0003 Score=46.95 Aligned_cols=33 Identities=27% Similarity=0.551 Sum_probs=28.1 Q ss_pred EEEEEEEEECCCC-EEEEECCCCCCHHHHHHHHH Q ss_conf 7899998873898-18998899978889999999 Q gi|255764514|r 10 VLIESLDIDFSAG-LSILSGDTGSGKSILLDALI 42 (554) Q Consensus 10 ~~i~~~~i~f~~G-l~vItGetGaGKS~ildAl~ 42 (554) ...+++++++.+| +.+|+||+|||||+++-+|. T Consensus 26 ~~l~~vs~~i~~GE~l~ivGeSGsGKSTL~r~i~ 59 (266) T PRK10419 26 AVLNNVSLTLKSGETVALLGRSGCGKSTLARLLV 59 (266) T ss_pred EEEECCEEEECCCCEEEEECCCCCHHHHHHHHHH T ss_conf 8885817588899899999999977999999996 No 451 >PRK11607 potG putrescine transporter ATP-binding subunit; Provisional Probab=97.33 E-value=0.0027 Score=40.66 Aligned_cols=72 Identities=22% Similarity=0.303 Sum_probs=56.3 Q ss_pred HCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHH--CCCEEEEECHHHHHH-HCCCEEEEEE Q ss_conf 0621579999999998436689976998034468887999999999999730--593999808379865-0176179999 Q gi|255764514|r 428 ASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSK--KIQLLAVTHAPQVAA-RADRHFLVYK 504 (554) Q Consensus 428 aSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~--~~Qvi~ITH~pqvAa-~a~~h~~v~K 504 (554) +|||++=|+++|..++. ..+.++|||-=+|++-.+...+-..|+++-+ ..=+|.|||-...|. .||+ +.|-+ T Consensus 150 LSGGqrQRVaiArAL~~----~P~lLllDEPts~LD~~~r~~l~~~l~~l~~~~g~Tii~VTHD~~eA~~laDr-I~Vm~ 224 (377) T PRK11607 150 LSGGQRQRVALARSLAK----RPKLLLLDEPMGALDKKLRDRMQLEVVDILERVGVTCVMVTHDQEEAMTMAGR-IAIMN 224 (377) T ss_pred CCHHHHHHHHHHHHHHC----CCCEEEECCCCCCCCHHHHHHHHHHHHHHHHHHCCEEEEECCCHHHHHHHCCE-EEEEE T ss_conf 89868789999998744----99789964875447999999999999999997399999999899999986999-99998 No 452 >KOG1029 consensus Probab=97.33 E-value=0.014 Score=35.93 Aligned_cols=237 Identities=11% Similarity=0.049 Sum_probs=0.0 Q ss_pred HHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHC Q ss_conf 03678777766300001389999999999999988877665555433444433211000002344334677788898620 Q gi|255764514|r 137 DVQGHRKILDSYADIDLSLCELGTLYRHWCCTADALKKYQEQKSSSQDVEFLRFSIDELQALAVQPGEENELVVMRSKIL 216 (554) Q Consensus 137 ~~~~q~~lLD~~~~~~~~~~~~~~~~~~~~~~~~~l~~l~~~~~~~~e~e~l~~ql~El~~~~l~~~E~e~L~~~~~~l~ 216 (554) +....++-+...-..+..+.+-....++++...+.-++++.+++...+.|.-+. .+|+.-.....|.+......=.-. T Consensus 339 qqqreree~eqkEreE~ekkererqEqErk~qlElekqLerQReiE~qrEEerk--keie~rEaar~ElEkqRqlewEra 416 (1118) T KOG1029 339 QQQREREEVEQKEREEEEKKERERQEQERKAQLELEKQLERQREIERQREEERK--KEIERREAAREELEKQRQLEWERA 416 (1118) T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH--HHHHHHHHHHHHHHHHHHHHHHHH T ss_conf 889999999887777888878888889999899999999998999887788888--889999988888999999999999 Q ss_pred CCCCCCCCHHHHHHHHHCCCCHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHCCCHHHHH Q ss_conf 00123210234555320010017999999986543100110013667642221001079999999875300014876401 Q gi|255764514|r 217 KQERIAVELSSIMDDFHKSSSPISVISSMLRRLERKSTEVPDLLQKSISFLNEAQENLSDAQHEIERSFSEIQYDAQELA 296 (554) Q Consensus 217 ~~e~l~~~l~~~~~~l~~~~~~l~~l~~~~~~l~~~~~~~~~~l~~~~~~l~~~~~~l~e~~~el~~~~~~le~~~~~L~ 296 (554) ...++......-.+.+-........+...+..|..+...++..+....-.+......++.+....+....+++.-..++. T Consensus 417 r~qem~~Qk~reqe~iv~~nak~~ql~~eletLn~k~qqls~kl~Dvr~~~tt~kt~ie~~~~q~e~~isei~qlqarik 496 (1118) T KOG1029 417 RRQEMLNQKNREQEWIVYLNAKKKQLQQELETLNFKLQQLSGKLQDVRVDITTQKTEIEEVTKQRELMISEIDQLQARIK 496 (1118) T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHEECCCHHHHHHHHHHHHHHHHHHHHHHHHHHHH T ss_conf 99999852147777889987777788889999888999875334511003202778998765478888878999999999 Q ss_pred HHHHHH-----------HHHHHHHHHHCCCHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH Q ss_conf 235666-----------788887876201115688875200002666443345777778888876765211136678999 Q gi|255764514|r 297 NIEERL-----------FALRAMSRKYSVSIDQLPELAKKMEEDLADISEGNEKVVSLERVLYEARQAYDRVAQDISTKR 365 (554) Q Consensus 297 ~ie~Rl-----------~~l~~L~rK~~~~~eel~~~~~~l~~~l~~l~~~~~~l~~l~~~~~~~~~~l~~~a~~Ls~~R 365 (554) +.++.+ +.+.....-|+.+-.....+......+-.-.....+.+.++.++.+....+.+-....+.+.| T Consensus 497 E~q~kl~~l~~Ekq~l~~qlkq~q~a~~~~~~~~s~L~aa~~~ke~irq~ikdqldelskE~esk~~eidi~n~qlkelk 576 (1118) T KOG1029 497 ELQEKLQKLAPEKQELNHQLKQKQSAHKETTQRKSELEAARRKKELIRQAIKDQLDELSKETESKLNEIDIFNNQLKELK 576 (1118) T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH T ss_conf 99999876536889988999976640267515799999999879999999999999987888877776656777899999 Q ss_pred HHHHHHHHHH Q ss_conf 9999888999 Q gi|255764514|r 366 YQFAKMLEKN 375 (554) Q Consensus 366 ~~~a~~L~~~ 375 (554) ...-..+-.. T Consensus 577 ~~~~~q~lak 586 (1118) T KOG1029 577 EDVNSQQLAK 586 (1118) T ss_pred HHHHHHHHHH T ss_conf 9999999999 No 453 >KOG0058 consensus Probab=97.33 E-value=0.0019 Score=41.67 Aligned_cols=74 Identities=22% Similarity=0.314 Sum_probs=61.3 Q ss_pred HHCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCEEEEECHHHHHHHCCCEEEEEE Q ss_conf 406215799999999984366899769980344688879999999999997305939998083798650176179999 Q gi|255764514|r 427 LASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSKKIQLLAVTHAPQVAARADRHFLVYK 504 (554) Q Consensus 427 iaSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~~~Qvi~ITH~pqvAa~a~~h~~v~K 504 (554) -+|||.|=|++.|=.++ .++..+|+||--+.++.+.=..|-+-|.++.+++=||+|.|-=.---.||.-.+|.| T Consensus 604 qLSGGQKQRIAIARALl----r~P~VLILDEATSALDaeSE~lVq~aL~~~~~~rTVlvIAHRLSTV~~Ad~Ivvi~~ 677 (716) T KOG0058 604 QLSGGQKQRIAIARALL----RNPRVLILDEATSALDAESEYLVQEALDRLMQGRTVLVIAHRLSTVRHADQIVVIDK 677 (716) T ss_pred CCCCHHHHHHHHHHHHH----HCCCEEEEECHHHHCCHHHHHHHHHHHHHHHCCCEEEEEEEHHHHHHHCCEEEEECC T ss_conf 06631889999999985----099889882411211212199999999885358769998512456641668999718 No 454 >TIGR00968 3a0106s01 sulfate ABC transporter, ATP-binding protein; InterPro: IPR005666 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems. ABC transporters are minimally constituted of two conserved regions: a highly conserved ATP binding cassette (ABC) and a less conserved transmembrane domain (TMD). These regions can be found on the same protein or on two different ones. Most ABC transporters function as a dimer and therefore are constituted of four domains, two ABC modules and two TMDs. ABC transporters are involved in the export or import of a wide variety of substrates ranging from small ions to macromolecules. The major function of ABC import systems is to provide essential nutrients to bacteria. They are found only in prokaryotes and their four constitutive domains are usually encoded by independent polypeptides (two ABC proteins and two TMD proteins). Prokaryotic importers require additional extracytoplasmic binding proteins (one or more per systems) for function. In contrast, export systems are involved in the extrusion of noxious substances, the export of extracellular toxins and the targeting of membrane components. They are found in all living organisms and in general the TMD is fused to the ABC module in a variety of combinations. Some eukaryotic exporters encode the four domains on the same polypeptide chain . The ABC module (approximately two hundred amino acid residues) is known to bind and hydrolyze ATP, thereby coupling transport to ATP hydrolysis in a large number of biological processes. The cassette is duplicated in several subfamilies. Its primary sequence is highly conserved, displaying a typical phosphate-binding loop: Walker A, and a magnesium binding site: Walker B. Besides these two regions, three other conserved motifs are present in the ABC cassette: the switch region which contains a histidine loop, postulated to polarize the attaching water molecule for hydrolysis, the signature conserved motif (LSGGQ) specific to the ABC transporter, and the Q-motif (between Walker A and the signature), which interacts with the gamma phosphate through a water bond. The Walker A, Walker B, Q-loop and switch region form the nucleotide binding site , , . The 3D structure of a monomeric ABC module adopts a stubby L-shape with two distinct arms. ArmI (mainly beta-strand) contains Walker A and Walker B. The important residues for ATP hydrolysis and/or binding are located in the P-loop. The ATP-binding pocket is located at the extremity of armI. The perpendicular armII contains mostly the alpha helical subdomain with the signature motif. It only seems to be required for structural integrity of the ABC module. ArmII is in direct contact with the TMD. The hinge between armI and armII contains both the histidine loop and the Q-loop, making contact with the gamma phosphate of the ATP molecule. ATP hydrolysis leads to a conformational change that could facilitate ADP release. In the dimer the two ABC cassettes contact each other through hydrophobic interactions at the antiparallel beta-sheet of armI by a two-fold axis , , , , , . Proteins known to belong to this family are classified in several functional subfamilies depending on the substrate used (for further information see http://www.tcdb.org/tcdb/index.php?tc=3.A.1). These proteins are involved in the transmembrane transport of sulphate and thiosulphate.; GO: 0042626 ATPase activity coupled to transmembrane movement of substances, 0006810 transport, 0016020 membrane. Probab=97.32 E-value=0.00039 Score=46.23 Aligned_cols=55 Identities=25% Similarity=0.439 Sum_probs=38.0 Q ss_pred CCEEEEEEEEECCCC-EEEEECCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCEEEE Q ss_conf 227899998873898-18998899978889999999871473253311289725899 Q gi|255764514|r 8 NIVLIESLDIDFSAG-LSILSGDTGSGKSILLDALILVTGGRGDGGLVRRHAEKGQV 63 (554) Q Consensus 8 Nf~~i~~~~i~f~~G-l~vItGetGaGKS~ildAl~~~lG~r~~~~~Ir~g~~~a~V 63 (554) +|..+++++++...| |+++-||+|||||+||-.|.- |-...+...+-+|.+-+.+ T Consensus 12 ~f~al~~v~l~v~~G~lvaLLGPSGSGKsTLLR~iAG-Le~pd~G~I~~~G~D~t~~ 67 (241) T TIGR00968 12 SFQALDDVDLEVPTGSLVALLGPSGSGKSTLLRVIAG-LEQPDSGRIILNGRDATRV 67 (241) T ss_pred CEEEEEEEEEEECCCEEEEEECCCCCCHHHHHHHHHC-CCCCCCCEEEEEECCCCCC T ss_conf 5477534555743852798546898737899999835-7999842699852002213 No 455 >KOG0065 consensus Probab=97.30 E-value=0.00018 Score=48.43 Aligned_cols=49 Identities=22% Similarity=0.296 Sum_probs=41.9 Q ss_pred CCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCEEEE-ECHHHHHHH Q ss_conf 6899769980344688879999999999997305939998-083798650 Q gi|255764514|r 447 QGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSKKIQLLAV-THAPQVAAR 495 (554) Q Consensus 447 ~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~~~Qvi~I-TH~pqvAa~ 495 (554) .+|.+.+.+||--+|++-++|..|-+.||+++..-|-|+. =|+|-+--+ T Consensus 946 A~P~~ilFLDEPTSGLDsqaA~~i~~~lrkla~tGqtIlCTIHQPS~~if 995 (1391) T KOG0065 946 ANPSSILFLDEPTSGLDSQAAAIVMRFLRKLADTGQTILCTIHQPSIDIF 995 (1391) T ss_pred CCCCEEEEECCCCCCCCHHHHHHHHHHHHHHHHCCCEEEEEECCCCHHHH T ss_conf 28755688569987745789999999999998648869998158708999 No 456 >TIGR00630 uvra excinuclease ABC, A subunit; InterPro: IPR004602 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems. ABC transporters are minimally constituted of two conserved regions: a highly conserved ATP binding cassette (ABC) and a less conserved transmembrane domain (TMD). These regions can be found on the same protein or on two different ones. Most ABC transporters function as a dimer and therefore are constituted of four domains, two ABC modules and two TMDs. ABC transporters are involved in the export or import of a wide variety of substrates ranging from small ions to macromolecules. The major function of ABC import systems is to provide essential nutrients to bacteria. They are found only in prokaryotes and their four constitutive domains are usually encoded by independent polypeptides (two ABC proteins and two TMD proteins). Prokaryotic importers require additional extracytoplasmic binding proteins (one or more per systems) for function. In contrast, export systems are involved in the extrusion of noxious substances, the export of extracellular toxins and the targeting of membrane components. They are found in all living organisms and in general the TMD is fused to the ABC module in a variety of combinations. Some eukaryotic exporters encode the four domains on the same polypeptide chain . The ABC module (approximately two hundred amino acid residues) is known to bind and hydrolyze ATP, thereby coupling transport to ATP hydrolysis in a large number of biological processes. The cassette is duplicated in several subfamilies. Its primary sequence is highly conserved, displaying a typical phosphate-binding loop: Walker A, and a magnesium binding site: Walker B. Besides these two regions, three other conserved motifs are present in the ABC cassette: the switch region which contains a histidine loop, postulated to polarize the attaching water molecule for hydrolysis, the signature conserved motif (LSGGQ) specific to the ABC transporter, and the Q-motif (between Walker A and the signature), which interacts with the gamma phosphate through a water bond. The Walker A, Walker B, Q-loop and switch region form the nucleotide binding site , , . The 3D structure of a monomeric ABC module adopts a stubby L-shape with two distinct arms. ArmI (mainly beta-strand) contains Walker A and Walker B. The important residues for ATP hydrolysis and/or binding are located in the P-loop. The ATP-binding pocket is located at the extremity of armI. The perpendicular armII contains mostly the alpha helical subdomain with the signature motif. It only seems to be required for structural integrity of the ABC module. ArmII is in direct contact with the TMD. The hinge between armI and armII contains both the histidine loop and the Q-loop, making contact with the gamma phosphate of the ATP molecule. ATP hydrolysis leads to a conformational change that could facilitate ADP release. In the dimer the two ABC cassettes contact each other through hydrophobic interactions at the antiparallel beta-sheet of armI by a two-fold axis , , , , , . Proteins known to belong to this family are classified in several functional subfamilies depending on the substrate used (for further information see http://www.tcdb.org/tcdb/index.php?tc=3.A.1). During the process of Escherichia coli nucleotide excision repair, DNA damage recognition and processing are achieved by the action of the uvrA, uvrB, and uvrC gene products . The UvrC protein contain 4 conserved regions: a central region which interact with UvrB (Uvr domain), a Helix hairpin Helix (HhH) domain important for 5 prime incision of damage DNA and the homology regions 1 and 2 of unknown function. UvrC homology region 2 is specific for UvrC proteins, whereas UvrC homology region 1 is also shared by few other nucleases.; GO: 0009381 excinuclease ABC activity, 0006289 nucleotide-excision repair, 0009380 excinuclease repair complex. Probab=97.30 E-value=0.00019 Score=48.26 Aligned_cols=105 Identities=24% Similarity=0.306 Sum_probs=68.4 Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEEEECCCCCCCCCCCCCCEEEEECCCCCCCCHHH---HHHCCHHHHH Q ss_conf 6678999999988899999766652025633786520253223446543200110127899831135---4406215799 Q gi|255764514|r 359 QDISTKRYQFAKMLEKNVMAEMPALKLENVCFTVNITSDKEDISPDGIDRVEFYVQTNRGENPGPLM---KLASGGELSR 435 (554) Q Consensus 359 ~~Ls~~R~~~a~~L~~~i~~~L~~L~m~~a~f~i~~~~~~~~~~~~G~d~v~f~~s~n~g~~~~pl~---kiaSGGE~Sr 435 (554) ..|....++.|+.+=++|.+.|.-| + |-|-+.-.|+ ..+||||.=| T Consensus 478 ~~L~~~~~~IA~~iLKEI~~RL~FL-----------------------------~--dVGL~YL~L~R~A~TLSGGEaQR 526 (956) T TIGR00630 478 LKLTEEEKKIAEEILKEIKERLKFL-----------------------------I--DVGLDYLTLSRAAGTLSGGEAQR 526 (956) T ss_pred ECCCHHHHHHHHHHHHHHHHHHHHH-----------------------------H--HCCCCCCCCCCCCCCCCCCHHHH T ss_conf 0266678999999999999888887-----------------------------6--43777577144354344517899 Q ss_pred HHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHH---HHHHHHHCCCEEEEECHHHHHHHCCC Q ss_conf 9999999843668997699803446888799999999---99997305939998083798650176 Q gi|255764514|r 436 FLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGY---RLKQLSKKIQLLAVTHAPQVAARADR 498 (554) Q Consensus 436 ~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~---~l~~ls~~~Qvi~ITH~pqvAa~a~~ 498 (554) |.||=+.= +..-.+ .||+||-=-|+=-+=-.++=+ .|+.|+. =||||=|=+|.=..||+ T Consensus 527 IRLAtQiG-S~L~GV-LYVLDEPSIGLHqrDN~rLI~TL~~LRDLGN--TliVVEHDe~Ti~~AD~ 588 (956) T TIGR00630 527 IRLATQIG-SGLTGV-LYVLDEPSIGLHQRDNERLINTLKRLRDLGN--TLIVVEHDEETIRAADY 588 (956) T ss_pred HHHHHHHC-CCEEEE-EEEECCCCCCCCHHHHHHHHHHHHHHHHCCC--EEEEEECCHHHHHHCCE T ss_conf 99998723-512567-8884178888873456899999999850398--79999174799855796 No 457 >KOG0062 consensus Probab=97.29 E-value=0.0012 Score=42.96 Aligned_cols=76 Identities=21% Similarity=0.251 Sum_probs=56.6 Q ss_pred CCHHHHHHCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCEEEEECHHHHHHH-CCCE Q ss_conf 311354406215799999999984366899769980344688879999999999997305939998083798650-1761 Q gi|255764514|r 421 PGPLMKLASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSKKIQLLAVTHAPQVAAR-ADRH 499 (554) Q Consensus 421 ~~pl~kiaSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~~~Qvi~ITH~pqvAa~-a~~h 499 (554) .+|+. .+|||.+||+++|-..- ..+-++|+||.--.++-.+...+++-|+.... =|++|||-...-.. -+-+ T Consensus 477 ~~si~-~LSGGQKsrvafA~~~~----~~PhlLVLDEPTNhLD~dsl~AL~~Al~~F~G--GVv~VSHd~~fi~~~c~E~ 549 (582) T KOG0062 477 LQSIA-SLSGGQKSRVAFAACTW----NNPHLLVLDEPTNHLDRDSLGALAKALKNFNG--GVVLVSHDEEFISSLCKEL 549 (582) T ss_pred HCCCC-CCCCCCHHHHHHHHHHC----CCCCEEEECCCCCCCCHHHHHHHHHHHHHCCC--CEEEEECCHHHHHHCCCEE T ss_conf 35022-36786216999998743----79868984488763367778999999985589--4799977589986317305 Q ss_pred EEEE Q ss_conf 7999 Q gi|255764514|r 500 FLVY 503 (554) Q Consensus 500 ~~v~ 503 (554) |.|. T Consensus 550 Wvve 553 (582) T KOG0062 550 WVVE 553 (582) T ss_pred EEEC T ss_conf 9973 No 458 >COG5265 ATM1 ABC-type transport system involved in Fe-S cluster assembly, permease and ATPase components [Posttranslational modification, protein turnover, chaperones] Probab=97.29 E-value=0.0014 Score=42.46 Aligned_cols=91 Identities=24% Similarity=0.348 Sum_probs=68.3 Q ss_pred HCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCEEEEECHHHHHHHCCCEEEEEEEEC Q ss_conf 06215799999999984366899769980344688879999999999997305939998083798650176179999621 Q gi|255764514|r 428 ASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSKKIQLLAVTHAPQVAARADRHFLVYKTNK 507 (554) Q Consensus 428 aSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~~~Qvi~ITH~pqvAa~a~~h~~v~K~~~ 507 (554) .||||+-|++.|= .+. +.+|.+||||--+.++..|-..+-.-|+++|+++--+||-|-----.-||.-++.. . T Consensus 400 lSggekqrvaiar--~il--k~p~il~~deatsaldt~te~~iq~~l~~~~~~rttlviahrlsti~~adeiivl~-~-- 472 (497) T COG5265 400 LSGGEKQRVAIAR--TIL--KNPPILILDEATSALDTHTEQAIQAALREVSAGRTTLVIAHRLSTIIDADEIIVLD-N-- 472 (497) T ss_pred CCCCHHHHHHHHH--HHH--CCCCEEEEECHHHHCCCHHHHHHHHHHHHHHCCCEEEEEEEHHHHCCCCCEEEEEE-C-- T ss_conf 1375378899999--986--08987998052332320149999999999847983899842222005776699962-8-- Q ss_pred CCCCCEEEEEEEECCHHHHHHHHHHHHCCC Q ss_conf 687525899999759889999999986688 Q gi|255764514|r 508 PDDTQRIETYVAVLTPQERREEIARMLAGS 537 (554) Q Consensus 508 ~~~~~~~~~~i~~l~~~~r~~Eiarml~g~ 537 (554) | .|. +..+-.|+-+| +|. T Consensus 473 -g-------~i~---erg~h~~ll~~-~g~ 490 (497) T COG5265 473 -G-------RIV---ERGTHEELLAA-GGL 490 (497) T ss_pred -C-------EEE---ECCCHHHHHHC-CCH T ss_conf -8-------776---23767999975-884 No 459 >KOG0054 consensus Probab=97.27 E-value=0.00032 Score=46.75 Aligned_cols=75 Identities=25% Similarity=0.405 Sum_probs=55.5 Q ss_pred HHHCCHH-HH---HHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCEEEEECHHHHHHHCCCEEE Q ss_conf 4406215-79---9999999984366899769980344688879999999999997305939998083798650176179 Q gi|255764514|r 426 KLASGGE-LS---RFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSKKIQLLAVTHAPQVAARADRHFL 501 (554) Q Consensus 426 kiaSGGE-~S---r~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~~~Qvi~ITH~pqvAa~a~~h~~ 501 (554) ++..||| .| |=++.|--|+-+ .+..+|+||--|+|+.+|-..+=+.+++-=+++=||+|-|-=.----.|+=++ T Consensus 1268 ~v~EgG~NfSvGQRQLlCLARALLr--~skILvLDEATAsVD~~TD~lIQ~tIR~~F~dcTVLtIAHRl~TVmd~DrVlV 1345 (1381) T KOG0054 1268 EVSEGGENFSVGQRQLLCLARALLR--KSKILVLDEATASVDPETDALIQKTIREEFKDCTVLTIAHRLNTVMDSDRVLV 1345 (1381) T ss_pred EECCCCCCCCHHHHHHHHHHHHHHC--CCCEEEEECCCCCCCHHHHHHHHHHHHHHHCCCEEEEEEECCCCHHCCCEEEE T ss_conf 6167983487778999999999962--27889996442347867899999999998378969997201660431675899 Q ss_pred E Q ss_conf 9 Q gi|255764514|r 502 V 502 (554) Q Consensus 502 v 502 (554) . T Consensus 1346 l 1346 (1381) T KOG0054 1346 L 1346 (1381) T ss_pred E T ss_conf 6 No 460 >PRK11432 fbpC ferric transporter ATP-binding subunit; Provisional Probab=97.27 E-value=0.0018 Score=41.90 Aligned_cols=71 Identities=30% Similarity=0.396 Sum_probs=46.2 Q ss_pred HCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHC--CCEEEEECHHHHH-HHCCCEEEE Q ss_conf 06215799999999984366899769980344688879999999999997305--9399980837986-501761799 Q gi|255764514|r 428 ASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSKK--IQLLAVTHAPQVA-ARADRHFLV 502 (554) Q Consensus 428 aSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~~--~Qvi~ITH~pqvA-a~a~~h~~v 502 (554) +|||++=|++||-.++ .....++|||-=++++-..-..+-..|+++-+. .=+|.|||-+.-| ++||+=.+. T Consensus 137 LSGGq~QRValARAL~----~~P~vlLlDEP~s~LD~~lR~~~~~~l~~l~~~~~~T~i~VTHD~~EA~~laDrI~vm 210 (351) T PRK11432 137 ISGGQQQRVALARALV----LKPKVLLFDEPLSNLDANLRRSMREKIRELQQQFNITSLYVTHDQSEAFAVSDTVIVM 210 (351) T ss_pred CCHHHHHHHHHHHHHH----CCCCEEEECCCCCCCCHHHHHHHHHHHHHHHHHHCCEEEEECCCHHHHHHHCCEEEEE T ss_conf 8998999999999984----4998999868754369999999999999999986999999999989999869999999 No 461 >TIGR02204 MsbA_rel ABC transporter, permease/ATP-binding protein; InterPro: IPR011918 This protein is related to a Proteobacterial ATP transporter that exports lipid A and to eukaryotic P-glycoproteins .. Probab=97.27 E-value=0.00015 Score=48.89 Aligned_cols=80 Identities=25% Similarity=0.361 Sum_probs=62.1 Q ss_pred CCCCCCHHHHHHCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCEEEEECHHHHHHHC Q ss_conf 89983113544062157999999999843668997699803446888799999999999973059399980837986501 Q gi|255764514|r 417 RGENPGPLMKLASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSKKIQLLAVTHAPQVAARA 496 (554) Q Consensus 417 ~g~~~~pl~kiaSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~~~Qvi~ITH~pqvAa~a 496 (554) -|+.-. .+|||-+=|+ ||--++- ...|.+.+||==+.++-+.=..|=.-|..|.+.+=-+||=|-=----+| T Consensus 470 LGERGv----~LSGGQrQRI--AIARAiL--~dAPiLLLDEATSALDAeSE~~VqqALe~LM~gRTTLiIAHRLATV~~A 541 (576) T TIGR02204 470 LGERGV----TLSGGQRQRI--AIARAIL--KDAPILLLDEATSALDAESEQLVQQALEELMKGRTTLIIAHRLATVLKA 541 (576) T ss_pred CCCCCC----CCCCHHHHHH--HHHHHHH--CCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEHHHHHHHHHHHC T ss_conf 554430----2674246899--9999986--1788320156612633752899999999850479501137677998729 Q ss_pred CCEEEEEE Q ss_conf 76179999 Q gi|255764514|r 497 DRHFLVYK 504 (554) Q Consensus 497 ~~h~~v~K 504 (554) |+=.+..| T Consensus 542 DRI~VmD~ 549 (576) T TIGR02204 542 DRIVVMDQ 549 (576) T ss_pred CCEEEECC T ss_conf 80487047 No 462 >COG1132 MdlB ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms] Probab=97.26 E-value=0.00031 Score=46.91 Aligned_cols=118 Identities=25% Similarity=0.265 Sum_probs=51.8 Q ss_pred CCCCEEEEECCCCCCCCHHHHHHCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCC-CCHHHHHHHHHHHHHHHHCCCEE Q ss_conf 43200110127899831135440621579999999998436689976998034468-88799999999999973059399 Q gi|255764514|r 406 IDRVEFYVQTNRGENPGPLMKLASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSG-IGGAVADAIGYRLKQLSKKIQLL 484 (554) Q Consensus 406 ~d~v~f~~s~n~g~~~~pl~kiaSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDag-i~G~~a~~v~~~l~~ls~~~Qvi 484 (554) ..++.|.+. ||+...=. -.||.-|| +++.+..-+.....-..+| |.+|-. ++-.. +-+.+.=..++.+.+ T Consensus 345 l~~is~~i~--~Ge~vaiV--G~sGsGKS-Tl~~LL~r~~~~~~G~I~i-dg~dI~~i~~~~---lr~~i~~V~Qd~~LF 415 (567) T COG1132 345 LKDISFSIE--PGEKVAIV--GPSGSGKS-TLIKLLLRLYDPTSGEILI-DGIDIRDISLDS---LRKRIGIVSQDPLLF 415 (567) T ss_pred CCCCEEEEC--CCCEEEEE--CCCCCCHH-HHHHHHHHHCCCCCCEEEE-CCEEHHHCCHHH---HHHHEEEECCCCHHH T ss_conf 105227754--89878885--58888578-9999998615888836989-999777538567---887823546642777 Q ss_pred EEE---------------CHHHHHHHCCCEEEEEEEECCCCCCEEEEEE----EECCHHHHH-HHHHHHHCCC Q ss_conf 980---------------8379865017617999962168752589999----975988999-9999986688 Q gi|255764514|r 485 AVT---------------HAPQVAARADRHFLVYKTNKPDDTQRIETYV----AVLTPQERR-EEIARMLAGS 537 (554) Q Consensus 485 ~IT---------------H~pqvAa~a~~h~~v~K~~~~~~~~~~~~~i----~~l~~~~r~-~Eiarml~g~ 537 (554) --| -.-+.|..|..|=.|.+-...= .|.| ..|++-+|. --|||++--+ T Consensus 416 ~~TI~~NI~~g~~~at~eei~~a~k~a~~~d~I~~lp~g~-----dt~vge~G~~LSgGQrQriaiARall~~ 483 (567) T COG1132 416 SGTIRENIALGRPDATDEEIEEALKLANAHEFIANLPDGY-----DTIVGERGVNLSGGQRQRLAIARALLRN 483 (567) T ss_pred HHHHHHHHHCCCCCCCHHHHHHHHHHHCCHHHHHHCCCCC-----CCEECCCCCCCCHHHHHHHHHHHHHHHC T ss_conf 7669999745788999999999999948637898476667-----8360578871889999999999997036 No 463 >COG3840 ThiQ ABC-type thiamine transport system, ATPase component [Coenzyme metabolism] Probab=97.26 E-value=0.0019 Score=41.75 Aligned_cols=71 Identities=34% Similarity=0.417 Sum_probs=42.6 Q ss_pred HCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHC--CCEEEEECHHHHHHHCCCEEEE Q ss_conf 06215799999999984366899769980344688879999999999997305--9399980837986501761799 Q gi|255764514|r 428 ASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSKK--IQLLAVTHAPQVAARADRHFLV 502 (554) Q Consensus 428 aSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~~--~Qvi~ITH~pqvAa~a~~h~~v 502 (554) +||||.-|++||=.++ .+-|.+.+||-=+.++-.--.-+-.++.++... .-++.|||.|.=|+.-.....+ T Consensus 130 LSGGqRQRvALARclv----R~~PilLLDEPFsALdP~LR~eMl~Lv~~l~~E~~~TllmVTH~~~Da~~ia~~~~~ 202 (231) T COG3840 130 LSGGQRQRVALARCLV----REQPILLLDEPFSALDPALRAEMLALVSQLCDERKMTLLMVTHHPEDAARIADRVVF 202 (231) T ss_pred CCCHHHHHHHHHHHHH----CCCCEEEECCCHHHCCHHHHHHHHHHHHHHHHHHCCEEEEEECCHHHHHHHHHCEEE T ss_conf 4740778999999880----268757754811331978899999999999884287799995788899976520699 No 464 >PRK00349 uvrA excinuclease ABC subunit A; Reviewed Probab=97.26 E-value=0.0021 Score=41.45 Aligned_cols=75 Identities=28% Similarity=0.237 Sum_probs=61.0 Q ss_pred HHCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHC-CCEEEEECHHHHHHHCCCEEEEE Q ss_conf 406215799999999984366899769980344688879999999999997305-93999808379865017617999 Q gi|255764514|r 427 LASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSKK-IQLLAVTHAPQVAARADRHFLVY 503 (554) Q Consensus 427 iaSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~~-~Qvi~ITH~pqvAa~a~~h~~v~ 503 (554) .+||||.=|+-||=.+-- .... -+|||||-=.|+--+-..++-..|++|-.. .=||||-|=|.|-..||+-+-+= T Consensus 489 TLSGGE~QRirLa~qLgS-~L~g-vlYVLDEPSiGLHprD~~rLi~~L~~Lrd~GNTVlVVEHD~~~i~~AD~iIDlG 564 (944) T PRK00349 489 TLSGGEAQRIRLATQIGS-GLTG-VLYVLDEPSIGLHQRDNDRLIETLKRLRDLGNTLIVVEHDEDTIRAADYIVDIG 564 (944) T ss_pred CCCCHHHHHHHHHHHHCC-CCCC-EEEEECCCCCCCCHHHHHHHHHHHHHHHHCCCEEEEEECCHHHHHHCCEEEEEC T ss_conf 767148899999998656-6646-499936875547988999999999999857985999835687775287789717 No 465 >TIGR00954 3a01203 Peroxysomal long chain fatty acyl transporter; InterPro: IPR005283 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems. ABC transporters are minimally constituted of two conserved regions: a highly conserved ATP binding cassette (ABC) and a less conserved transmembrane domain (TMD). These regions can be found on the same protein or on two different ones. Most ABC transporters function as a dimer and therefore are constituted of four domains, two ABC modules and two TMDs. ABC transporters are involved in the export or import of a wide variety of substrates ranging from small ions to macromolecules. The major function of ABC import systems is to provide essential nutrients to bacteria. They are found only in prokaryotes and their four constitutive domains are usually encoded by independent polypeptides (two ABC proteins and two TMD proteins). Prokaryotic importers require additional extracytoplasmic binding proteins (one or more per systems) for function. In contrast, export systems are involved in the extrusion of noxious substances, the export of extracellular toxins and the targeting of membrane components. They are found in all living organisms and in general the TMD is fused to the ABC module in a variety of combinations. Some eukaryotic exporters encode the four domains on the same polypeptide chain . The ABC module (approximately two hundred amino acid residues) is known to bind and hydrolyze ATP, thereby coupling transport to ATP hydrolysis in a large number of biological processes. The cassette is duplicated in several subfamilies. Its primary sequence is highly conserved, displaying a typical phosphate-binding loop: Walker A, and a magnesium binding site: Walker B. Besides these two regions, three other conserved motifs are present in the ABC cassette: the switch region which contains a histidine loop, postulated to polarize the attaching water molecule for hydrolysis, the signature conserved motif (LSGGQ) specific to the ABC transporter, and the Q-motif (between Walker A and the signature), which interacts with the gamma phosphate through a water bond. The Walker A, Walker B, Q-loop and switch region form the nucleotide binding site , , . The 3D structure of a monomeric ABC module adopts a stubby L-shape with two distinct arms. ArmI (mainly beta-strand) contains Walker A and Walker B. The important residues for ATP hydrolysis and/or binding are located in the P-loop. The ATP-binding pocket is located at the extremity of armI. The perpendicular armII contains mostly the alpha helical subdomain with the signature motif. It only seems to be required for structural integrity of the ABC module. ArmII is in direct contact with the TMD. The hinge between armI and armII contains both the histidine loop and the Q-loop, making contact with the gamma phosphate of the ATP molecule. ATP hydrolysis leads to a conformational change that could facilitate ADP release. In the dimer the two ABC cassettes contact each other through hydrophobic interactions at the antiparallel beta-sheet of armI by a two-fold axis , , , , , . Proteins known to belong to this family are classified in several functional subfamilies depending on the substrate used (for further information see http://www.tcdb.org/tcdb/index.php?tc=3.A.1). The members of this family are integral membrane proteins and they are involved in the import of activated long-chain fatty acids from the cytosol to the peroxisomal matrix. ; GO: 0005524 ATP binding, 0006810 transport, 0016021 integral to membrane. Probab=97.25 E-value=0.00012 Score=49.56 Aligned_cols=67 Identities=21% Similarity=0.259 Sum_probs=48.7 Q ss_pred CCHHHHHHCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCC--CEEEEECHHHHHHH Q ss_conf 3113544062157999999999843668997699803446888799999999999973059--39998083798650 Q gi|255764514|r 421 PGPLMKLASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSKKI--QLLAVTHAPQVAAR 495 (554) Q Consensus 421 ~~pl~kiaSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~~~--Qvi~ITH~pqvAa~ 495 (554) ++.++.++||||+=|++.|=.+- .+| -|-|+||-=+.|| .-|=.+|=++.++. -+|.|||-|-.=-+ T Consensus 703 v~DW~DvLSGGEKQR~aMARlfY---HKP-~fA~LDECTSAVS----vDvE~~~y~~~~~~~I~L~svsHR~sLWKy 771 (788) T TIGR00954 703 VQDWKDVLSGGEKQRIAMARLFY---HKP-KFAVLDECTSAVS----VDVEGYMYRLAREAGITLISVSHRKSLWKY 771 (788) T ss_pred HHCCHHHHCCHHHHHHHHHHHHH---CCC-CCEEHHHCCCCCC----HHHHHHHHHHHHHCCCEEEEEECCCCHHHH T ss_conf 60706563332588789988852---488-5142101016667----648999999998659707885057442567 No 466 >PRK11308 dppF dipeptide transporter ATP-binding subunit; Provisional Probab=97.25 E-value=0.00031 Score=46.86 Aligned_cols=33 Identities=24% Similarity=0.520 Sum_probs=27.4 Q ss_pred EEEEEEEECCCC-EEEEECCCCCCHHHHHHHHHH Q ss_conf 899998873898-189988999788899999998 Q gi|255764514|r 11 LIESLDIDFSAG-LSILSGDTGSGKSILLDALIL 43 (554) Q Consensus 11 ~i~~~~i~f~~G-l~vItGetGaGKS~ildAl~~ 43 (554) -+++++++..+| ..+|+||+|||||+++.+|.. T Consensus 30 Av~~Vsl~i~~GE~lgiVGeSGsGKSTL~~~l~g 63 (327) T PRK11308 30 ALDGVSFNLERGKTLAVVGESGCGKSTLARLLTM 63 (327) T ss_pred EECCEEEEECCCCEEEEECCCCHHHHHHHHHHHC T ss_conf 8506067988999999999983199999999956 No 467 >COG3842 PotA ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism] Probab=97.25 E-value=0.0005 Score=45.47 Aligned_cols=35 Identities=26% Similarity=0.596 Sum_probs=30.8 Q ss_pred CCEEEEEEEEECCCC-EEEEECCCCCCHHHHHHHHH Q ss_conf 227899998873898-18998899978889999999 Q gi|255764514|r 8 NIVLIESLDIDFSAG-LSILSGDTGSGKSILLDALI 42 (554) Q Consensus 8 Nf~~i~~~~i~f~~G-l~vItGetGaGKS~ildAl~ 42 (554) ++..+++++++..+| |.++-||+|||||++|-.|. T Consensus 17 ~~~al~~isl~i~~Gef~tlLGPSGcGKTTlLR~IA 52 (352) T COG3842 17 DFTAVDDISLDIKKGEFVTLLGPSGCGKTTLLRMIA 52 (352) T ss_pred CEEEEECCEEEECCCCEEEEECCCCCCHHHHHHHHH T ss_conf 726773214454488689998998888899999996 No 468 >TIGR01166 cbiO cobalt ABC transporter, ATP-binding protein; InterPro: IPR005876 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems. ABC transporters are minimally constituted of two conserved regions: a highly conserved ATP binding cassette (ABC) and a less conserved transmembrane domain (TMD). These regions can be found on the same protein or on two different ones. Most ABC transporters function as a dimer and therefore are constituted of four domains, two ABC modules and two TMDs. ABC transporters are involved in the export or import of a wide variety of substrates ranging from small ions to macromolecules. The major function of ABC import systems is to provide essential nutrients to bacteria. They are found only in prokaryotes and their four constitutive domains are usually encoded by independent polypeptides (two ABC proteins and two TMD proteins). Prokaryotic importers require additional extracytoplasmic binding proteins (one or more per systems) for function. In contrast, export systems are involved in the extrusion of noxious substances, the export of extracellular toxins and the targeting of membrane components. They are found in all living organisms and in general the TMD is fused to the ABC module in a variety of combinations. Some eukaryotic exporters encode the four domains on the same polypeptide chain . The ABC module (approximately two hundred amino acid residues) is known to bind and hydrolyze ATP, thereby coupling transport to ATP hydrolysis in a large number of biological processes. The cassette is duplicated in several subfamilies. Its primary sequence is highly conserved, displaying a typical phosphate-binding loop: Walker A, and a magnesium binding site: Walker B. Besides these two regions, three other conserved motifs are present in the ABC cassette: the switch region which contains a histidine loop, postulated to polarize the attaching water molecule for hydrolysis, the signature conserved motif (LSGGQ) specific to the ABC transporter, and the Q-motif (between Walker A and the signature), which interacts with the gamma phosphate through a water bond. The Walker A, Walker B, Q-loop and switch region form the nucleotide binding site , , . The 3D structure of a monomeric ABC module adopts a stubby L-shape with two distinct arms. ArmI (mainly beta-strand) contains Walker A and Walker B. The important residues for ATP hydrolysis and/or binding are located in the P-loop. The ATP-binding pocket is located at the extremity of armI. The perpendicular armII contains mostly the alpha helical subdomain with the signature motif. It only seems to be required for structural integrity of the ABC module. ArmII is in direct contact with the TMD. The hinge between armI and armII contains both the histidine loop and the Q-loop, making contact with the gamma phosphate of the ATP molecule. ATP hydrolysis leads to a conformational change that could facilitate ADP release. In the dimer the two ABC cassettes contact each other through hydrophobic interactions at the antiparallel beta-sheet of armI by a two-fold axis , , , , , . Proteins known to belong to this family are classified in several functional subfamilies depending on the substrate used (for further information see http://www.tcdb.org/tcdb/index.php?tc=3.A.1). This entry represents the ATP binding subunit of the multisubunit cobalt transporter in bacteria and its equivalents in archaea. This superfamily includes two groups, one which catalyses the uptake of small molecules, including ions from the external milieu and the other group which is engaged in the efflux of small molecular weight compounds and ions from within the cell. Energy derived from the hydrolysis of ATP drives both the process of uptake and efflux.; GO: 0006824 cobalt ion transport, 0009276 1-2nm peptidoglycan-based cell wall. Probab=97.23 E-value=0.0002 Score=48.08 Aligned_cols=35 Identities=31% Similarity=0.445 Sum_probs=28.8 Q ss_pred EEEEEEEECCCC-EEEEECCCCCCHHHHHHHHHHHH Q ss_conf 899998873898-18998899978889999999871 Q gi|255764514|r 11 LIESLDIDFSAG-LSILSGDTGSGKSILLDALILVT 45 (554) Q Consensus 11 ~i~~~~i~f~~G-l~vItGetGaGKS~ildAl~~~l 45 (554) ..+.+++.|..| .++|-|+||||||+||--|+=.| T Consensus 7 vL~gln~~~~~G~~~aLlG~NGaGKsTLl~~LnG~L 42 (190) T TIGR01166 7 VLKGLNFAVERGEVLALLGANGAGKSTLLLHLNGLL 42 (190) T ss_pred CCCCCCEEECCCCEEEEECCCCCCHHHHHHHHCCCC T ss_conf 035423022057168987289985789988743677 No 469 >KOG0064 consensus Probab=97.23 E-value=0.00048 Score=45.64 Aligned_cols=103 Identities=22% Similarity=0.253 Sum_probs=62.9 Q ss_pred CHHHHHHCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCC--CEEEEECHHHHHHHCCCE Q ss_conf 113544062157999999999843668997699803446888799999999999973059--399980837986501761 Q gi|255764514|r 422 GPLMKLASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSKKI--QLLAVTHAPQVAARADRH 499 (554) Q Consensus 422 ~pl~kiaSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~~~--Qvi~ITH~pqvAa~a~~h 499 (554) ..++.++||||+-|+..|=.+- ..+.+-++||--+.||=. |-.++-+.+++. -+|.|||-|-.=-+ ++| T Consensus 607 ~dWkDvLSgGeKQRm~mARmfY----HrPkyalLDEcTSAVSiD----vE~~ifq~aK~~gisllSIthRpsLwky-Hth 677 (728) T KOG0064 607 RDWKDVLSGGEKQRMGMARMFY----HRPKYALLDECTSAVSID----VEGKIFQAAKDAGISLLSITHRPSLWKY-HTH 677 (728) T ss_pred HCHHHHCCHHHHHHHHHHHHHH----CCCCHHHHHHHHCCCCCC----HHHHHHHHHHHCCCEEEEEECCCCHHHH-HHH T ss_conf 0578770503888888999974----285147777673026612----4789999987459249985168519999-888 Q ss_pred EEEEEEECCCCCCEEEEE---EEECCHHHHHHHHHHHHCCC Q ss_conf 799996216875258999---99759889999999986688 Q gi|255764514|r 500 FLVYKTNKPDDTQRIETY---VAVLTPQERREEIARMLAGS 537 (554) Q Consensus 500 ~~v~K~~~~~~~~~~~~~---i~~l~~~~r~~Eiarml~g~ 537 (554) ++=. +++++--+.. -..|+.+|.+.|+-+-|.|. T Consensus 678 LL~f----Dg~Ggwqf~~~n~~~rls~~eek~eLe~qL~~v 714 (728) T KOG0064 678 LLEF----DGEGGWQFRALNTEERLSIEEEKQELESQLARV 714 (728) T ss_pred HHHC----CCCCCEEEECCCHHHHCCCHHHHHHHHHHHHHC T ss_conf 9712----688870320278465246178999999998628 No 470 >pfam00261 Tropomyosin Tropomyosin. Probab=97.23 E-value=0.018 Score=35.19 Aligned_cols=48 Identities=15% Similarity=0.329 Sum_probs=23.1 Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH Q ss_conf 3345777778888876765211136678999999988899999766652 Q gi|255764514|r 335 EGNEKVVSLERVLYEARQAYDRVAQDISTKRYQFAKMLEKNVMAEMPAL 383 (554) Q Consensus 335 ~~~~~l~~l~~~~~~~~~~l~~~a~~Ls~~R~~~a~~L~~~i~~~L~~L 383 (554) ....+....+..+..+...+..+-..|...+.+. ..+...+...|.+| T Consensus 187 e~e~r~e~ae~~~~~le~~i~~Le~eL~~~k~~~-~~~~~Eld~~l~el 234 (237) T pfam00261 187 EAETRAEFAERSVQKLEKEVDRLEDELLAEKEKY-KAISEELDQTLAEL 234 (237) T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-HHHHHHHHHHHHHH T ss_conf 9999999999999999999999999999999988-88999999999975 No 471 >PRK11000 maltose/maltodextrin transporter ATP-binding protein; Provisional Probab=97.22 E-value=0.0025 Score=40.89 Aligned_cols=72 Identities=25% Similarity=0.356 Sum_probs=42.2 Q ss_pred HCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHH--CCCEEEEECHHHHHHH-CCCEEEEEE Q ss_conf 0621579999999998436689976998034468887999999999999730--5939998083798650-176179999 Q gi|255764514|r 428 ASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSK--KIQLLAVTHAPQVAAR-ADRHFLVYK 504 (554) Q Consensus 428 aSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~--~~Qvi~ITH~pqvAa~-a~~h~~v~K 504 (554) +|||++=|++||-.++ ...+.++|||-=+|++-.....+-..|++|-+ ..=+|.|||-+..|.. ||+ +.|-+ T Consensus 134 LSGGq~QRvaiARAL~----~~P~illlDEP~s~LD~~~r~~~~~~l~~l~~~~g~T~i~vTHD~~eA~~laDr-I~Vm~ 208 (369) T PRK11000 134 LSGGQRQRVAIGRTLV----AEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADK-IVVLD 208 (369) T ss_pred CCHHHHHHHHHHHHHH----CCCCEEEECCCCCCCCHHHEEHHHHHHHHHHHHHCCEEEEEECCHHHHHHHCCE-EEEEE T ss_conf 6942779999998862----599858843666788866652478999999998698599990899999985999-99998 No 472 >TIGR02525 plasmid_TraJ plasmid transfer ATPase TraJ; InterPro: IPR013364 Proteins in this entry are predicted ATPases associated with plasmid transfer loci in bacteria. This family is most similar to the DotB ATPase (IPR013363 from INTERPRO) of a type-IV secretion-like system of the obligate intracellular pathogens Legionella pneumophila and Coxiella burnetii.. Probab=97.22 E-value=0.00021 Score=48.05 Aligned_cols=29 Identities=41% Similarity=0.512 Sum_probs=24.2 Q ss_pred CCCCEEEEECCCCCCHHHHHHHHHHHHCC Q ss_conf 38981899889997888999999987147 Q gi|255764514|r 19 FSAGLSILSGDTGSGKSILLDALILVTGG 47 (554) Q Consensus 19 f~~Gl~vItGetGaGKS~ildAl~~~lG~ 47 (554) ...||=.|.|+||||||+++-||-==+|. T Consensus 147 P~~GLGLiCG~TGSGKSTl~AaiY~~~l~ 175 (374) T TIGR02525 147 PKAGLGLICGETGSGKSTLAAAIYRHCLE 175 (374) T ss_pred CCCCCEEECCCCCCCHHHHHHHHHHHHCC T ss_conf 00378022177897289999999998507 No 473 >TIGR03258 PhnT 2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT. This ATP-binding component of an ABC transport system is found in Salmonella and Burkholderia lineages in the vicinity of enzymes for the breakdown of 2-aminoethylphosphonate. Probab=97.22 E-value=0.004 Score=39.58 Aligned_cols=98 Identities=23% Similarity=0.270 Sum_probs=69.7 Q ss_pred HCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHC---CCEEEEECHHHHHHHCCCEEEEEE Q ss_conf 06215799999999984366899769980344688879999999999997305---939998083798650176179999 Q gi|255764514|r 428 ASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSKK---IQLLAVTHAPQVAARADRHFLVYK 504 (554) Q Consensus 428 aSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~~---~Qvi~ITH~pqvAa~a~~h~~v~K 504 (554) +|||++-|++||-.++ ...+.++|||-=++++-.+-..+-..|+++-+. .=+|.|||-+.-|..=...+.|-+ T Consensus 138 LSGGq~QRVAlARAL~----~~P~ilLlDEP~saLD~~~r~~l~~~l~~l~~~l~~~T~i~VTHD~~EA~~laDrI~Vm~ 213 (362) T TIGR03258 138 LSGGMQQRIAIARAIA----IEPDVLLLDEPLSALDANIRANMREEIAALHEELPELTILCVTHDQDDALTLADKAGIMK 213 (362) T ss_pred CCHHHHHHHHHHHHHH----CCCCEEEECCCCCCCCHHHHHHHHHHHHHHHHHCCCCEEEEECCCHHHHHHHCCEEEEEE T ss_conf 8998999999999975----599989981887655999999999999999997679889998999899998589999998 Q ss_pred EECCCCCCEEEEEEEEC-CHHH-----HHHHHHHHHCCCCC Q ss_conf 62168752589999975-9889-----99999998668800 Q gi|255764514|r 505 TNKPDDTQRIETYVAVL-TPQE-----RREEIARMLAGSHI 539 (554) Q Consensus 505 ~~~~~~~~~~~~~i~~l-~~~~-----r~~Eiarml~g~~~ 539 (554) . + +|-.. ++++ .-.-+|+.+|-.++ T Consensus 214 ~---G-------~i~Q~gtp~eiy~~P~~~~vA~f~G~~n~ 244 (362) T TIGR03258 214 D---G-------RLAAHGEPQALYDAPADGFAAEFLGAANI 244 (362) T ss_pred C---C-------EEEEEECHHHHHHCCCCHHHHHHCCCCCC T ss_conf 9---9-------99998188999868998489751696432 No 474 >COG0411 LivG ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Probab=97.22 E-value=0.0001 Score=49.99 Aligned_cols=37 Identities=19% Similarity=0.434 Sum_probs=30.0 Q ss_pred CEEEEEEEEECCCC-EEEEECCCCCCHHHHHHHHHHHH Q ss_conf 27899998873898-18998899978889999999871 Q gi|255764514|r 9 IVLIESLDIDFSAG-LSILSGDTGSGKSILLDALILVT 45 (554) Q Consensus 9 f~~i~~~~i~f~~G-l~vItGetGaGKS~ildAl~~~l 45 (554) +.-+++++++..+| ++.|+||||||||+++.-|+=.+ T Consensus 17 l~Al~~Vsl~v~~Gei~~LIGPNGAGKTTlfNlitG~~ 54 (250) T COG0411 17 LTAVNDVSLEVRPGEIVGLIGPNGAGKTTLFNLITGFY 54 (250) T ss_pred EEEEECEEEEECCCEEEEEECCCCCCCEEEEEEECCCC T ss_conf 89970414787387289998899888245665323640 No 475 >COG1125 OpuBA ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism] Probab=97.22 E-value=0.00062 Score=44.87 Aligned_cols=39 Identities=23% Similarity=0.422 Sum_probs=33.8 Q ss_pred ECCEEEEEEEEECCCC-EEEEECCCCCCHHHHHHHHHHHH Q ss_conf 4227899998873898-18998899978889999999871 Q gi|255764514|r 7 YNIVLIESLDIDFSAG-LSILSGDTGSGKSILLDALILVT 45 (554) Q Consensus 7 ~Nf~~i~~~~i~f~~G-l~vItGetGaGKS~ildAl~~~l 45 (554) .|...++++++++.+| |+|+.||+|||||++|.-|+=+. T Consensus 12 ~~~~av~~v~l~I~~gef~vliGpSGsGKTTtLkMINrLi 51 (309) T COG1125 12 GNKKAVDDVNLTIEEGEFLVLIGPSGSGKTTTLKMINRLI 51 (309) T ss_pred CCCEEEEEEEEEECCCEEEEEECCCCCCHHHHHHHHHCCC T ss_conf 7732332225776597289998789975787999996055 No 476 >COG1129 MglA ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism] Probab=97.21 E-value=0.00039 Score=46.19 Aligned_cols=77 Identities=22% Similarity=0.357 Sum_probs=58.2 Q ss_pred CHHHHHHCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHC-CCEEEE-ECHHHHHHHCCCE Q ss_conf 11354406215799999999984366899769980344688879999999999997305-939998-0837986501761 Q gi|255764514|r 422 GPLMKLASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSKK-IQLLAV-THAPQVAARADRH 499 (554) Q Consensus 422 ~pl~kiaSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~~-~Qvi~I-TH~pqvAa~a~~h 499 (554) +|+. -+|||-.=.+.||=-++ ..++++||||--.||+=.+-.-+-+++++|++. .=||+| |-+|-+-..+|+= T Consensus 397 ~~v~-~LSGGNQQKVvlarwL~----~~p~vLilDEPTRGIDVGAK~eIy~li~~lA~~G~ail~iSSElpEll~~~DRI 471 (500) T COG1129 397 QPIG-TLSGGNQQKVVLARWLA----TDPKVLILDEPTRGIDVGAKAEIYRLIRELAAEGKAILMISSELPELLGLSDRI 471 (500) T ss_pred CHHH-CCCCHHHHHHHHHHHHH----HCCCEEEECCCCCCCCCCHHHHHHHHHHHHHHCCCEEEEEECCHHHHHHHCCEE T ss_conf 6111-07736566999999997----589999988998775414589999999999977998999949759988409779 Q ss_pred EEEE Q ss_conf 7999 Q gi|255764514|r 500 FLVY 503 (554) Q Consensus 500 ~~v~ 503 (554) ++.. T Consensus 472 lVm~ 475 (500) T COG1129 472 LVMR 475 (500) T ss_pred EEEE T ss_conf 9998 No 477 >COG0410 LivF ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Probab=97.21 E-value=0.00068 Score=44.63 Aligned_cols=36 Identities=22% Similarity=0.514 Sum_probs=24.3 Q ss_pred EEEEEEEECCCC-EEEEECCCCCCHHHHHHHHHHHHC Q ss_conf 899998873898-189988999788899999998714 Q gi|255764514|r 11 LIESLDIDFSAG-LSILSGDTGSGKSILLDALILVTG 46 (554) Q Consensus 11 ~i~~~~i~f~~G-l~vItGetGaGKS~ildAl~~~lG 46 (554) .+..++++..+| .+++.|+||||||+++.||+-+.- T Consensus 18 ~L~gvsl~v~~Geiv~llG~NGaGKTTlLkti~Gl~~ 54 (237) T COG0410 18 ALRGVSLEVERGEIVALLGRNGAGKTTLLKTIMGLVR 54 (237) T ss_pred EEEEEEEEECCCCEEEEECCCCCCHHHHHHHHHCCCC T ss_conf 8851105876898899989998888999999858987 No 478 >cd03284 ABC_MutS1 MutS1 homolog in eukaryotes. The MutS protein initiates DNA mismatch repair by recognizing mispaired and unpaired bases embedded in duplex DNA and activating endo- and exonucleases to remove the mismatch. Members of the MutS family possess C-terminal domain with a conserved ATPase activity that belongs to the ATP binding cassette (ABC) superfamily. MutS homologs (MSH) have been identified in most prokaryotic and all eukaryotic organisms examined. Prokaryotes have two homologs (MutS1 and MutS2), whereas seven MSH proteins (MSH1 to MSH7) have been identified in eukaryotes. The homodimer MutS1 and heterodimers MSH2-MSH3 and MSH2-MSH6 are primarily involved in mitotic mismatch repair, whereas MSH4-MSH5 is involved in resolution of Holliday junctions during meiosis. All members of the MutS family contain the highly conserved Walker A/B ATPase domain, and many share a common mechanism of action. MutS1, MSH2-MSH3, MSH2-MSH6, and MSH4-MSH5 dimerize to form sliding clam Probab=97.19 E-value=0.015 Score=35.82 Aligned_cols=28 Identities=25% Similarity=0.438 Sum_probs=13.6 Q ss_pred EEECCCCEEEEECCCCCCHHHHHHHHHH Q ss_conf 8873898189988999788899999998 Q gi|255764514|r 16 DIDFSAGLSILSGDTGSGKSILLDALIL 43 (554) Q Consensus 16 ~i~f~~Gl~vItGetGaGKS~ildAl~~ 43 (554) .++.+..+.+|||||.+|||++|.++.+ T Consensus 25 ~l~~~~~~~iiTGpN~sGKSt~Lk~igl 52 (216) T cd03284 25 ELDPERQILLITGPNMAGKSTYLRQVAL 52 (216) T ss_pred EECCCCEEEEEECCCCCCHHHHHHHHHH T ss_conf 9789845999989987745999999999 No 479 >COG1124 DppF ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Probab=97.19 E-value=0.0018 Score=41.76 Aligned_cols=73 Identities=23% Similarity=0.274 Sum_probs=55.7 Q ss_pred HCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCC--CEEEEECHHHHHHHCCCEEEEEE Q ss_conf 062157999999999843668997699803446888799999999999973059--39998083798650176179999 Q gi|255764514|r 428 ASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSKKI--QLLAVTHAPQVAARADRHFLVYK 504 (554) Q Consensus 428 aSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~~~--Qvi~ITH~pqvAa~a~~h~~v~K 504 (554) +|||++-|+++|-.++. ...++|+||.=+.++-.+-..|=++|.++-+.+ =+|.|||-=.++.+=-.-+.|-. T Consensus 142 LSGGQ~QRiaIARAL~~----~PklLIlDEptSaLD~siQa~IlnlL~~l~~~~~lt~l~IsHdl~~v~~~cdRi~Vm~ 216 (252) T COG1124 142 LSGGQRQRIAIARALIP----EPKLLILDEPTSALDVSVQAQILNLLLELKKERGLTYLFISHDLALVEHMCDRIAVMD 216 (252) T ss_pred CCHHHHHHHHHHHHHCC----CCCEEEECCCHHHHCHHHHHHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHEEEEE T ss_conf 28168999999998636----8887995382344158899999999999998619459999672999998853525400 No 480 >COG2274 SunT ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms] Probab=97.18 E-value=0.00041 Score=46.09 Aligned_cols=48 Identities=25% Similarity=0.297 Sum_probs=26.4 Q ss_pred CCCCEEEEECCCCCCCCHHHHHHCCHHHHHHHHHHHHHHCCCCC-CCEEEEECCCC Q ss_conf 43200110127899831135440621579999999998436689-97699803446 Q gi|255764514|r 406 IDRVEFYVQTNRGENPGPLMKLASGGELSRFLLALKIVLVDQGS-IPTLVFDEVDS 460 (554) Q Consensus 406 ~d~v~f~~s~n~g~~~~pl~kiaSGGE~Sr~~LAl~~~~~~~~~-~p~~ifDEiDa 460 (554) .+++.+-+. ||+...=++ .||-=|| +++ |....-+.| .....+|.+|- T Consensus 489 L~~isL~I~--~Ge~vaIvG--~SGsGKS-TL~--KLL~gly~p~~G~I~~dg~dl 537 (709) T COG2274 489 LEDLSLEIP--PGEKVAIVG--RSGSGKS-TLL--KLLLGLYKPQQGRILLDGVDL 537 (709) T ss_pred HHCEEEEEC--CCCEEEEEC--CCCCCHH-HHH--HHHHCCCCCCCCEEEECCEEH T ss_conf 215027767--998899987--9999889-999--998367888885599998727 No 481 >COG3845 ABC-type uncharacterized transport systems, ATPase components [General function prediction only] Probab=97.15 E-value=0.0005 Score=45.52 Aligned_cols=108 Identities=23% Similarity=0.362 Sum_probs=76.5 Q ss_pred EEEE-CCCCCCCCHHHHHHCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCC-CEEE-EE Q ss_conf 1101-2789983113544062157999999999843668997699803446888799999999999973059-3999-80 Q gi|255764514|r 411 FYVQ-TNRGENPGPLMKLASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSKKI-QLLA-VT 487 (554) Q Consensus 411 f~~s-~n~g~~~~pl~kiaSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~~~-Qvi~-IT 487 (554) |-+. ++|..|... +|||-.=++.+|=.+. .....+|+...--|++=.++..+-+.|.++.+.- =|++ -+ T Consensus 390 fdVr~~~~~~~a~~----LSGGNqQK~IlaREl~----~~p~lLI~~qPTrGLDvgA~~~I~~~l~e~r~~G~AVLLiS~ 461 (501) T COG3845 390 FDVRAPSPDAPARS----LSGGNQQKLILARELA----RRPDLLIAAQPTRGLDVGAIEFIHERLLELRDAGKAVLLISE 461 (501) T ss_pred CCCCCCCCCCCHHH----CCCCCEEHHHHHHHHC----CCCCEEEECCCCCCCCHHHHHHHHHHHHHHHHCCCEEEEEEH T ss_conf 19437998762100----5873311001013550----599889986878664689999999999999866987999961 Q ss_pred CHHHHHHHCCCEEEEEEEECCCCCCEEEEEEEECCHH-HHHHHHHHHHCC Q ss_conf 8379865017617999962168752589999975988-999999998668 Q gi|255764514|r 488 HAPQVAARADRHFLVYKTNKPDDTQRIETYVAVLTPQ-ERREEIARMLAG 536 (554) Q Consensus 488 H~pqvAa~a~~h~~v~K~~~~~~~~~~~~~i~~l~~~-~r~~Eiarml~g 536 (554) -|-.+=+.+|+=++++.--. +..+..+ .-..+|..|++| T Consensus 462 dLDEil~lsDrIaVi~~Gri----------~~~~~~~~~t~~~iG~lM~G 501 (501) T COG3845 462 DLDEILELSDRIAVIYEGRI----------VGIVPPEEATREEIGLLMAG 501 (501) T ss_pred HHHHHHHHHHEEEEEECCCE----------ECCCCCCCCCHHHHHHHHCC T ss_conf 07899975214410018806----------02206453798998885459 No 482 >COG0488 Uup ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] Probab=97.15 E-value=0.0018 Score=41.78 Aligned_cols=36 Identities=33% Similarity=0.446 Sum_probs=29.2 Q ss_pred EEEEEEEEECCCC-EEEEECCCCCCHHHHHHHHHHHH Q ss_conf 7899998873898-18998899978889999999871 Q gi|255764514|r 10 VLIESLDIDFSAG-LSILSGDTGSGKSILLDALILVT 45 (554) Q Consensus 10 ~~i~~~~i~f~~G-l~vItGetGaGKS~ildAl~~~l 45 (554) .+++++++.|.+| =..|+|+||||||++|..|.-.+ T Consensus 17 ~l~~~~~l~~~~G~riGLvG~NGaGKSTLLkilaG~~ 53 (530) T COG0488 17 PLLENVSLTLNPGERIGLVGRNGAGKSTLLKILAGEL 53 (530) T ss_pred EEECCCCEEECCCCEEEEECCCCCCHHHHHHHHHCCC T ss_conf 5204784076899889998999898899999982997 No 483 >TIGR03415 ABC_choXWV_ATP choline ABC transporter, ATP-binding protein. Members of this protein family are the ATP-binding subunit of a three-protein transporter. This family belongs, more broadly, to the family of proline and glycine-betaine transporters, but members have been identified by direct characterization and by bioinformatic means as choline transporters. Many species have several closely-related members of this family, probably with variable abilities to act additionally on related quaternary amines. Probab=97.15 E-value=0.0061 Score=38.36 Aligned_cols=10 Identities=20% Similarity=0.484 Sum_probs=5.5 Q ss_pred CEEEEECCCC Q ss_conf 8189988999 Q gi|255764514|r 22 GLSILSGDTG 31 (554) Q Consensus 22 Gl~vItGetG 31 (554) +++-|-|++. T Consensus 5 ~l~kiFG~~~ 14 (382) T TIGR03415 5 NVDVVFGDQP 14 (382) T ss_pred EEEEECCCCH T ss_conf 7899528998 No 484 >COG4178 ABC-type uncharacterized transport system, permease and ATPase components [General function prediction only] Probab=97.15 E-value=0.0027 Score=40.69 Aligned_cols=81 Identities=20% Similarity=0.255 Sum_probs=67.8 Q ss_pred CHHHHHHCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCEEEEECHHHHHHHCCCEEE Q ss_conf 11354406215799999999984366899769980344688879999999999997305939998083798650176179 Q gi|255764514|r 422 GPLMKLASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSKKIQLLAVTHAPQVAARADRHFL 501 (554) Q Consensus 422 ~pl~kiaSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~~~Qvi~ITH~pqvAa~a~~h~~ 501 (554) .+..+++||||+-|+++|=... . .| ...++||--++++..+..++-.+|++--...=||.|.|.|-+..+.+.-.. T Consensus 510 ~~W~~vLS~GEqQRlafARilL-~--kP-~~v~LDEATsALDe~~e~~l~q~l~~~lp~~tvISV~Hr~tl~~~h~~~l~ 585 (604) T COG4178 510 DRWDRVLSGGEQQRLAFARLLL-H--KP-KWVFLDEATSALDEETEDRLYQLLKEELPDATVISVGHRPTLWNFHSRQLE 585 (604) T ss_pred CCHHHHCCHHHHHHHHHHHHHH-C--CC-CEEEEECCHHCCCHHHHHHHHHHHHHHCCCCEEEEECCCHHHHHHHHHHEE T ss_conf 7576645852789999999997-0--99-989980601125957899999999854899789995560005788754323 Q ss_pred EEEEE Q ss_conf 99962 Q gi|255764514|r 502 VYKTN 506 (554) Q Consensus 502 v~K~~ 506 (554) +.+.. T Consensus 586 l~~~~ 590 (604) T COG4178 586 LLDDA 590 (604) T ss_pred ECCCC T ss_conf 11466 No 485 >TIGR02633 xylG D-xylose ABC transporter, ATP-binding protein; InterPro: IPR013455 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems. ABC transporters are minimally constituted of two conserved regions: a highly conserved ATP binding cassette (ABC) and a less conserved transmembrane domain (TMD). These regions can be found on the same protein or on two different ones. Most ABC transporters function as a dimer and therefore are constituted of four domains, two ABC modules and two TMDs. ABC transporters are involved in the export or import of a wide variety of substrates ranging from small ions to macromolecules. The major function of ABC import systems is to provide essential nutrients to bacteria. They are found only in prokaryotes and their four constitutive domains are usually encoded by independent polypeptides (two ABC proteins and two TMD proteins). Prokaryotic importers require additional extracytoplasmic binding proteins (one or more per systems) for function. In contrast, export systems are involved in the extrusion of noxious substances, the export of extracellular toxins and the targeting of membrane components. They are found in all living organisms and in general the TMD is fused to the ABC module in a variety of combinations. Some eukaryotic exporters encode the four domains on the same polypeptide chain . The ABC module (approximately two hundred amino acid residues) is known to bind and hydrolyze ATP, thereby coupling transport to ATP hydrolysis in a large number of biological processes. The cassette is duplicated in several subfamilies. Its primary sequence is highly conserved, displaying a typical phosphate-binding loop: Walker A, and a magnesium binding site: Walker B. Besides these two regions, three other conserved motifs are present in the ABC cassette: the switch region which contains a histidine loop, postulated to polarize the attaching water molecule for hydrolysis, the signature conserved motif (LSGGQ) specific to the ABC transporter, and the Q-motif (between Walker A and the signature), which interacts with the gamma phosphate through a water bond. The Walker A, Walker B, Q-loop and switch region form the nucleotide binding site , , . The 3D structure of a monomeric ABC module adopts a stubby L-shape with two distinct arms. ArmI (mainly beta-strand) contains Walker A and Walker B. The important residues for ATP hydrolysis and/or binding are located in the P-loop. The ATP-binding pocket is located at the extremity of armI. The perpendicular armII contains mostly the alpha helical subdomain with the signature motif. It only seems to be required for structural integrity of the ABC module. ArmII is in direct contact with the TMD. The hinge between armI and armII contains both the histidine loop and the Q-loop, making contact with the gamma phosphate of the ATP molecule. ATP hydrolysis leads to a conformational change that could facilitate ADP release. In the dimer the two ABC cassettes contact each other through hydrophobic interactions at the antiparallel beta-sheet of armI by a two-fold axis , , , , , . Proteins known to belong to this family are classified in several functional subfamilies depending on the substrate used (for further information see http://www.tcdb.org/tcdb/index.php?tc=3.A.1). Several bacterial species use the enzymes xylose isomerase and xylulokinase for xylose utilisation. This entry represents the ATP-binding cassette (ABC) subunit of the known, or predicted, high-affinity xylose ABC transporter used for xylose import. The genes encoding these proteins, which closely resemble other sugar transport ABC transporter genes, are typically found near xylose utilisation enzymes and regulatory proteins. . Probab=97.14 E-value=0.00094 Score=43.70 Aligned_cols=80 Identities=24% Similarity=0.344 Sum_probs=55.2 Q ss_pred CCCHHHHHHCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCC-CEEEE-ECHHHHHHHCC Q ss_conf 83113544062157999999999843668997699803446888799999999999973059-39998-08379865017 Q gi|255764514|r 420 NPGPLMKLASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSKKI-QLLAV-THAPQVAARAD 497 (554) Q Consensus 420 ~~~pl~kiaSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~~~-Qvi~I-TH~pqvAa~a~ 497 (554) |+-|+..+ |||-.-...||=.+.+ +| ..+|+||---||+=-+-.-+=+++..|++.- -+|+| +-||-|=..+| T Consensus 398 P~LpI~~L-SGGNQQKA~Lak~Ll~---~P-~~LILDEPTRG~DvGAKyEIYkL~~~La~~G~a~iv~SSEL~EVLG~sD 472 (501) T TIGR02633 398 PFLPIGRL-SGGNQQKAVLAKMLLL---NP-RVLILDEPTRGVDVGAKYEIYKLINQLAQEGVAIIVVSSELAEVLGLSD 472 (501) T ss_pred CCCCCCCC-CCCHHHHHHHHHHHHC---CC-CEEEEECCCCCCCCCCHHHHHHHHHHHHHCCCEEEEECCCCHHHCCCCC T ss_conf 87542236-7730579999998743---99-4899747888610364078999999998479589998343100305522 Q ss_pred CEEEEEE Q ss_conf 6179999 Q gi|255764514|r 498 RHFLVYK 504 (554) Q Consensus 498 ~h~~v~K 504 (554) +=+++.. T Consensus 473 RVLV~~e 479 (501) T TIGR02633 473 RVLVIGE 479 (501) T ss_pred EEEEEEC T ss_conf 3788736 No 486 >COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] Probab=97.13 E-value=0.0029 Score=40.44 Aligned_cols=37 Identities=27% Similarity=0.492 Sum_probs=30.4 Q ss_pred CEEEEEEEEECCCC-EEEEECCCCCCHHHHHHHHHHHH Q ss_conf 27899998873898-18998899978889999999871 Q gi|255764514|r 9 IVLIESLDIDFSAG-LSILSGDTGSGKSILLDALILVT 45 (554) Q Consensus 9 f~~i~~~~i~f~~G-l~vItGetGaGKS~ildAl~~~l 45 (554) +-..+.+++++.+| ..+|+||+|||||++|..|+.+= T Consensus 15 ~~VLkgi~l~v~~Gevv~iiGpSGSGKSTlLRclN~LE 52 (240) T COG1126 15 KEVLKGISLSVEKGEVVVIIGPSGSGKSTLLRCLNGLE 52 (240) T ss_pred EEEECCCCEEECCCCEEEEECCCCCCHHHHHHHHHCCC T ss_conf 17764851167389789998999998889999997786 No 487 >pfam04310 MukB MukB N-terminal. This family represents the N-terminal region of MukB, one of a group of bacterial proteins essential for the movement of nucleoids from mid-cell towards the cell quarters (i.e. chromosome partitioning). The structure of the N-terminal domain consists of an antiparallel six-stranded beta sheet surrounded by one helix on one side and by five helices on the other side. It contains an exposed Walker A loop in an unexpected helix-loop-helix motif (in other proteins, Walker A motifs generally adopt a P loop conformation as part of a strand-loop-helix motif embedded in a conserved topology of alternating helices and (parallel) beta strands). Probab=97.12 E-value=0.0011 Score=43.14 Aligned_cols=44 Identities=27% Similarity=0.334 Sum_probs=39.0 Q ss_pred CEEEEECCEEEEEEEEECCCCEEEEECCCCCCHHHHHHHHHHHH Q ss_conf 25999422789999887389818998899978889999999871 Q gi|255764514|r 2 TRLSIYNIVLIESLDIDFSAGLSILSGDTGSGKSILLDALILVT 45 (554) Q Consensus 2 ~~L~i~Nf~~i~~~~i~f~~Gl~vItGetGaGKS~ildAl~~~l 45 (554) .+|++-|+-.|=--++++..-.|.+.|.||||||+++.|.-.+| T Consensus 8 rSLtlVNwNGffARTfdLd~lvttLsG~NGAGKsT~m~Af~tal 51 (227) T pfam04310 8 QSLTLINWNGFFARTFDIDELVTTLSGGNGAGKSTTMAAFITAL 51 (227) T ss_pred CEEEEEEECCEEEEEEECCEEEEEEECCCCCCHHHHHHHHHHHH T ss_conf 34789856367767740210268864478765487999999986 No 488 >KOG0060 consensus Probab=97.11 E-value=0.00081 Score=44.13 Aligned_cols=75 Identities=19% Similarity=0.198 Sum_probs=59.0 Q ss_pred CHHHHHHCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCEEEEECHHHHHHHCCCEEE Q ss_conf 11354406215799999999984366899769980344688879999999999997305939998083798650176179 Q gi|255764514|r 422 GPLMKLASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSKKIQLLAVTHAPQVAARADRHFL 501 (554) Q Consensus 422 ~pl~kiaSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~~~Qvi~ITH~pqvAa~a~~h~~ 501 (554) ..+..++||||+=|++.|=.|.. .| .+-|+||--+.|+-.+-..+.+++++++= -+|.|.|-+-.-.+-|.-+. T Consensus 565 ~dW~dvLS~GEqQRLa~ARLfy~---kP-k~AiLDE~TSAv~~dvE~~~Yr~~r~~gi--T~iSVgHRkSL~kfHd~~L~ 638 (659) T KOG0060 565 WDWMDVLSPGEQQRLAFARLFYH---KP-KFAILDECTSAVTEDVEGALYRKCREMGI--TFISVGHRKSLWKFHDYVLR 638 (659) T ss_pred CCHHHHCCHHHHHHHHHHHHHHC---CC-CEEEEECCHHHCCHHHHHHHHHHHHHCCC--EEEEECCHHHHHHHHHEEEE T ss_conf 05776369888889999999860---88-36876030222357679999999998097--69996357889865417999 Q ss_pred E Q ss_conf 9 Q gi|255764514|r 502 V 502 (554) Q Consensus 502 v 502 (554) + T Consensus 639 ~ 639 (659) T KOG0060 639 M 639 (659) T ss_pred E T ss_conf 6 No 489 >COG0444 DppD ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Probab=97.10 E-value=0.0061 Score=38.34 Aligned_cols=38 Identities=24% Similarity=0.517 Sum_probs=31.8 Q ss_pred CEEEEEEEEECCCC-EEEEECCCCCCHHHHHHHHHHHHC Q ss_conf 27899998873898-189988999788899999998714 Q gi|255764514|r 9 IVLIESLDIDFSAG-LSILSGDTGSGKSILLDALILVTG 46 (554) Q Consensus 9 f~~i~~~~i~f~~G-l~vItGetGaGKS~ildAl~~~lG 46 (554) +..++++++++.+| .-.|+||+|||||++.-||.-++- T Consensus 18 v~av~~vs~~i~~GE~lgiVGESGsGKS~~~~aim~llp 56 (316) T COG0444 18 VKAVDGVSFELKKGEILGIVGESGSGKSVLAKAIMGLLP 56 (316) T ss_pred EEEEECEEEEECCCCEEEEECCCCCCHHHHHHHHHHCCC T ss_conf 777714058875896899983897889999999984668 No 490 >PRK10070 glycine betaine transporter ATP-binding subunit; Provisional Probab=97.10 E-value=0.0071 Score=37.89 Aligned_cols=12 Identities=0% Similarity=0.113 Sum_probs=8.1 Q ss_pred EEEEECCEEEEC Q ss_conf 799999988410 Q gi|255764514|r 102 TKAYVNDQVVSV 113 (554) Q Consensus 102 S~~~INg~~v~~ 113 (554) ...++||+.++. T Consensus 83 G~I~i~G~di~~ 94 (400) T PRK10070 83 GQVLIDGVDIAK 94 (400) T ss_pred CEEEECCEECCC T ss_conf 189999999998 No 491 >COG0178 UvrA Excinuclease ATPase subunit [DNA replication, recombination, and repair] Probab=97.09 E-value=0.012 Score=36.38 Aligned_cols=97 Identities=22% Similarity=0.190 Sum_probs=65.3 Q ss_pred HHCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHH-CCCEEEEECHHHHHHHCCCEEEEEEE Q ss_conf 40621579999999998436689976998034468887999999999999730-59399980837986501761799996 Q gi|255764514|r 427 LASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSK-KIQLLAVTHAPQVAARADRHFLVYKT 505 (554) Q Consensus 427 iaSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~-~~Qvi~ITH~pqvAa~a~~h~~v~K~ 505 (554) .+||||.=|+-||-.+.-.. ....+|||||--+|+-=.-..++=+.|.+|-. -.-||||-|-=.|-..||+=+=+=-+ T Consensus 822 TLSGGEaQRvKLA~EL~k~~-tg~TlYiLDEPTTGLH~~Di~kLl~VL~rLvd~GnTViVIEHNLdVIk~AD~IIDLGPe 900 (935) T COG0178 822 TLSGGEAQRVKLAKELSKRS-TGKTLYILDEPTTGLHFDDIKKLLEVLHRLVDKGNTVIVIEHNLDVIKTADWIIDLGPE 900 (935) T ss_pred CCCCHHHHHHHHHHHHHHCC-CCCEEEEECCCCCCCCHHHHHHHHHHHHHHHHCCCEEEEEECCCCEEEECCEEEECCCC T ss_conf 66626999999999986346-89748996789878899999999999999984898799996366457526888972887 Q ss_pred ECCCCCCEEEEEEEECCHHHHHHHHHH Q ss_conf 216875258999997598899999999 Q gi|255764514|r 506 NKPDDTQRIETYVAVLTPQERREEIAR 532 (554) Q Consensus 506 ~~~~~~~~~~~~i~~l~~~~r~~Eiar 532 (554) ..++ ++ .-|.. ...+|+|. T Consensus 901 GG~~-GG---~iva~----GTPeeva~ 919 (935) T COG0178 901 GGDG-GG---EIVAS----GTPEEVAK 919 (935) T ss_pred CCCC-CC---EEEEE----CCHHHHHH T ss_conf 7777-75---59995----18999973 No 492 >TIGR03375 type_I_sec_LssB type I secretion system ATPase, LssB family. Type I protein secretion is a system in some Gram-negative bacteria to export proteins (often proteases) across both inner and outer membranes to the extracellular medium. This is one of three proteins of the type I secretion apparatus. Targeted proteins are not cleaved at the N-terminus, but rather carry signals located toward the extreme C-terminus to direct type I secretion. This model is related to models TIGR01842 and TIGR01846, and to bacteriocin ABC transporters that cleave their substrates during export. Probab=97.08 E-value=0.00032 Score=46.82 Aligned_cols=48 Identities=27% Similarity=0.308 Sum_probs=24.9 Q ss_pred CCCCEEEEECCCCCCCCHHHHHHCCHHHHHHHHHHHHHHCCCCC-CCEEEEECCCC Q ss_conf 43200110127899831135440621579999999998436689-97699803446 Q gi|255764514|r 406 IDRVEFYVQTNRGENPGPLMKLASGGELSRFLLALKIVLVDQGS-IPTLVFDEVDS 460 (554) Q Consensus 406 ~d~v~f~~s~n~g~~~~pl~kiaSGGE~Sr~~LAl~~~~~~~~~-~p~~ifDEiDa 460 (554) .++|.|-+. ||+...=.+ .||.=|| +++-+ ...-+.| .....+|-+|. T Consensus 481 l~~vsl~i~--~Ge~vaIvG--~sGsGKS-TL~kl--l~Gl~~p~~G~i~idg~~~ 529 (694) T TIGR03375 481 LDNVSLTIR--PGEKVAIIG--RIGSGKS-TLLKL--LLGLYQPTEGSVLLDGVDI 529 (694) T ss_pred HCCHHHEEC--CCCEEEEEE--CCCCCHH-HHHHH--HCCCCCCCCCEEEECCEEC T ss_conf 136311887--997899980--5898788-99998--5567589988799898542 No 493 >KOG0061 consensus Probab=97.08 E-value=0.0006 Score=44.96 Aligned_cols=17 Identities=12% Similarity=0.194 Sum_probs=7.6 Q ss_pred EEEECCEEEECHHHHHH Q ss_conf 99999988410112221 Q gi|255764514|r 103 KAYVNDQVVSVNFMRAV 119 (554) Q Consensus 103 ~~~INg~~v~~~~L~~l 119 (554) ...+||++......+.+ T Consensus 89 ~ilvNG~~~~~~~~~~~ 105 (613) T KOG0061 89 EILLNGRPRDSRSFRKI 105 (613) T ss_pred EEEECCCCCCHHHHHHC T ss_conf 99989822764552000 No 494 >COG1118 CysA ABC-type sulfate/molybdate transport systems, ATPase component [Inorganic ion transport and metabolism] Probab=97.07 E-value=0.00059 Score=45.00 Aligned_cols=40 Identities=28% Similarity=0.447 Sum_probs=31.7 Q ss_pred ECCEEEEEEEEECCCC-EEEEECCCCCCHHHHHHHHHHHHC Q ss_conf 4227899998873898-189988999788899999998714 Q gi|255764514|r 7 YNIVLIESLDIDFSAG-LSILSGDTGSGKSILLDALILVTG 46 (554) Q Consensus 7 ~Nf~~i~~~~i~f~~G-l~vItGetGaGKS~ildAl~~~lG 46 (554) -+|.-.++++++...| +.++.||+|||||++|..|.-+.. T Consensus 13 ~~~~a~~di~l~i~~Ge~vaLlGpSGaGKsTlLRiIAGLe~ 53 (345) T COG1118 13 GAFGALDDISLDIKSGELVALLGPSGAGKSTLLRIIAGLET 53 (345) T ss_pred CCCCCCCCCEEEECCCCEEEEECCCCCCHHHHHHHHHCCCC T ss_conf 55421146315506886899977898767889999857577 No 495 >TIGR00960 3a0501s02 Type II (General) Secretory Pathway (IISP) Family protein; InterPro: IPR013505 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems. ABC transporters are minimally constituted of two conserved regions: a highly conserved ATP binding cassette (ABC) and a less conserved transmembrane domain (TMD). These regions can be found on the same protein or on two different ones. Most ABC transporters function as a dimer and therefore are constituted of four domains, two ABC modules and two TMDs. ABC transporters are involved in the export or import of a wide variety of substrates ranging from small ions to macromolecules. The major function of ABC import systems is to provide essential nutrients to bacteria. They are found only in prokaryotes and their four constitutive domains are usually encoded by independent polypeptides (two ABC proteins and two TMD proteins). Prokaryotic importers require additional extracytoplasmic binding proteins (one or more per systems) for function. In contrast, export systems are involved in the extrusion of noxious substances, the export of extracellular toxins and the targeting of membrane components. They are found in all living organisms and in general the TMD is fused to the ABC module in a variety of combinations. Some eukaryotic exporters encode the four domains on the same polypeptide chain . The ABC module (approximately two hundred amino acid residues) is known to bind and hydrolyze ATP, thereby coupling transport to ATP hydrolysis in a large number of biological processes. The cassette is duplicated in several subfamilies. Its primary sequence is highly conserved, displaying a typical phosphate-binding loop: Walker A, and a magnesium binding site: Walker B. Besides these two regions, three other conserved motifs are present in the ABC cassette: the switch region which contains a histidine loop, postulated to polarize the attaching water molecule for hydrolysis, the signature conserved motif (LSGGQ) specific to the ABC transporter, and the Q-motif (between Walker A and the signature), which interacts with the gamma phosphate through a water bond. The Walker A, Walker B, Q-loop and switch region form the nucleotide binding site , , . The 3D structure of a monomeric ABC module adopts a stubby L-shape with two distinct arms. ArmI (mainly beta-strand) contains Walker A and Walker B. The important residues for ATP hydrolysis and/or binding are located in the P-loop. The ATP-binding pocket is located at the extremity of armI. The perpendicular armII contains mostly the alpha helical subdomain with the signature motif. It only seems to be required for structural integrity of the ABC module. ArmII is in direct contact with the TMD. The hinge between armI and armII contains both the histidine loop and the Q-loop, making contact with the gamma phosphate of the ATP molecule. ATP hydrolysis leads to a conformational change that could facilitate ADP release. In the dimer the two ABC cassettes contact each other through hydrophobic interactions at the antiparallel beta-sheet of armI by a two-fold axis , , , , , . Proteins known to belong to this family are classified in several functional subfamilies depending on the substrate used (for further information see http://www.tcdb.org/tcdb/index.php?tc=3.A.1). FtsE is an ABC transporter ATP-binding protein. This protein and its permease partner FtsX, localize to the cell division site. In a number of species, the ftsEX gene pair is located next to ftsY, which encodes the signal recognition particle-docki ng protein.; GO: 0005524 ATP binding, 0051301 cell division. Probab=97.06 E-value=0.00056 Score=45.16 Aligned_cols=31 Identities=29% Similarity=0.684 Sum_probs=25.9 Q ss_pred EEEEEEECCCC-EEEEECCCCCCHHHHHHHHH Q ss_conf 99998873898-18998899978889999999 Q gi|255764514|r 12 IESLDIDFSAG-LSILSGDTGSGKSILLDALI 42 (554) Q Consensus 12 i~~~~i~f~~G-l~vItGetGaGKS~ildAl~ 42 (554) .+++++...+| |.-|+|++|||||++|.=|+ T Consensus 19 L~~~~~~~~kGem~fL~GHSGaGKST~lkLi~ 50 (216) T TIGR00960 19 LDNVTFHIDKGEMVFLVGHSGAGKSTLLKLIL 50 (216) T ss_pred HCCCEEEECCCCEEEEECCCCCCHHHHHHHHH T ss_conf 03864785385079985688860789999998 No 496 >TIGR00606 rad50 rad50; InterPro: IPR004584 Rad50 is involved in recombination, recombinational repair, and/or non-homologous end joining. It is a component of an exonuclease complex with MRE11 homologs. The Saccharomyces cerevisiae Rad50/MRE11 complex possesses single-stranded endonuclease activity and ATP-dependent double-strand-specific exonuclease activity. Rad50 provides an ATP-dependent control of MRE11 by unwinding and repositioning DNA ends into the MRE11 active site. This family is distantly related to the SbcC family of bacterial proteins. When the N- and C-terminal globular regions of Rad50 from Pyrococcus furiosus P58301 from SWISSPROT are co-expressed in Escherichia coli, they spontaneously associate to form a stable complex that possesses ATP-binding and weak ATP-hydrolysing activities. The structure formed is known as the Rad50 catalytic domain (Rad50cd1). In the presence of ATP, two Rad50cd1 molecules interact via their ATP-binding and highly conserved 'signature' motifs to form a dimer. As ATP is buried deep within this dimer interface, the two Rad50cd1 molecules may have to completely disengage after ATP hydrolysis to allow the release of ADP before binding of a new ATP molecule. ATP binding is also accompanied by a 30° rotation of two distinct domains within each Rad50cd1 part of the dimer. This rotation and dimerisation creates a positively charged surface which, potentially, could provide a DNA-binding site capable of accommodating two DNA molecules. The Mre11-docking site within Rad50 has been mapped to two 40-residue heptad-repeat sequences that lie adjacent to the N- and C-terminal ATPase segments. A distinct region within this domain forms a conserved hydrophobic patch that is believed to be the actual Mre11-binding site and lies immediately adjacent to the putative DNA-binding site of Rad50. As Rad50 dimerises in the presence of ATP and forms a stoichiometric complex with Mre11 (one Mre11 subunit binding to one Rad50 subunit), it is possible that the MR complex forms a closely coordinated DNA-binding unit that has the potential to act on two DNA molecules simultaneously. Within this unit, ATP-dependent control of nuclease action might be achieved via Rad50 unwinding or repositioning DNA ends into the active-site of Mre11 . ; GO: 0005524 ATP binding, 0006281 DNA repair, 0030870 Mre11 complex. Probab=97.05 E-value=0.027 Score=34.07 Aligned_cols=95 Identities=16% Similarity=0.242 Sum_probs=67.1 Q ss_pred EEECCCC-CCCCHHHHHHCCHHHHHHHHHHHHHHCCC--CCCCEEEEECCCCCCCHHHHHHHHHHHHHHH---------- Q ss_conf 1012789-98311354406215799999999984366--8997699803446888799999999999973---------- Q gi|255764514|r 412 YVQTNRG-ENPGPLMKLASGGELSRFLLALKIVLVDQ--GSIPTLVFDEVDSGIGGAVADAIGYRLKQLS---------- 478 (554) Q Consensus 412 ~~s~n~g-~~~~pl~kiaSGGE~Sr~~LAl~~~~~~~--~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls---------- 478 (554) .+-.-.| ..+---++. |-|-+-...|-|++|+|.. .+..++-+||.-+|++-...+.+|-.|-++= T Consensus 1193 ~~V~~~GdT~~~MRGRC-SAGQK~LASL~IRlALAE~F~~~C~~iALDEPTTNLD~~~~E~lA~~L~~II~~R~GfdenG 1271 (1328) T TIGR00606 1193 RVVMLKGDTALDMRGRC-SAGQKVLASLLIRLALAEVFCLNCGIIALDEPTTNLDREKVESLAIVLVEIIKERSGFDENG 1271 (1328) T ss_pred EEEEECCCCEECCCCCC-CHHHHHHHHHHHHHHHHHHHCCCCCEEEECCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCC T ss_conf 67863387102036665-54579999999999998764024442440588765664468899999999985305755366 Q ss_pred ----HCCCEEEEECHHHH------HHHCCCEEEEEEEEC Q ss_conf ----05939998083798------650176179999621 Q gi|255764514|r 479 ----KKIQLLAVTHAPQV------AARADRHFLVYKTNK 507 (554) Q Consensus 479 ----~~~Qvi~ITH~pqv------Aa~a~~h~~v~K~~~ 507 (554) ++.|.+||||=-.. ..+..+-|.|.|... T Consensus 1272 kl~~R~~Ql~VITHDE~~V~~l~~S~~~E~~Y~~~K~~~ 1310 (1328) T TIGR00606 1272 KLRQRDFQLLVITHDEDLVELLGRSEYVEKIYRLKKDED 1310 (1328) T ss_pred CCCCCCEEEEEEECCHHHHHHHHHCCCCCEEEEECCCCC T ss_conf 512562158887355789986210024220145415743 No 497 >TIGR02533 type_II_gspE general secretory pathway protein E; InterPro: IPR013369 GspE, the E protein of the type II secretion system, is also referred to as the main terminal branch of the general secretion pathway. ; GO: 0005524 ATP binding, 0008565 protein transporter activity, 0015628 protein secretion by the type II secretion system, 0015627 type II protein secretion system complex. Probab=97.05 E-value=0.00035 Score=46.55 Aligned_cols=19 Identities=47% Similarity=0.770 Sum_probs=8.3 Q ss_pred CEEEEECCCCCCHHHHHHH Q ss_conf 8189988999788899999 Q gi|255764514|r 22 GLSILSGDTGSGKSILLDA 40 (554) Q Consensus 22 Gl~vItGetGaGKS~ildA 40 (554) |.-.+|||||||||+-|=| T Consensus 246 GIiLVTGPTGSGKtTTLYa 264 (495) T TIGR02533 246 GIILVTGPTGSGKTTTLYA 264 (495) T ss_pred CEEEECCCCCCCHHHHHHH T ss_conf 6188417789852588999 No 498 >cd03243 ABC_MutS_homologs The MutS protein initiates DNA mismatch repair by recognizing mispaired and unpaired bases embedded in duplex DNA and activating endo- and exonucleases to remove the mismatch. Members of the MutS family also possess a conserved ATPase activity that belongs to the ATP binding cassette (ABC) superfamily. MutS homologs (MSH) have been identified in most prokaryotic and all eukaryotic organisms examined. Prokaryotes have two homologs (MutS1 and MutS2), whereas seven MSH proteins (MSH1 to MSH7) have been identified in eukaryotes. The homodimer MutS1 and heterodimers MSH2-MSH3 and MSH2-MSH6 are primarily involved in mitotic mismatch repair, whereas MSH4-MSH5 is involved in resolution of Holliday junctions during meiosis. All members of the MutS family contain the highly conserved Walker A/B ATPase domain, and many share a common mechanism of action. MutS1, MSH2-MSH3, MSH2-MSH6, and MSH4-MSH5 dimerize to form sliding clamps, and recognition of specific DNA stru Probab=97.02 E-value=0.00092 Score=43.75 Aligned_cols=30 Identities=33% Similarity=0.577 Sum_probs=23.6 Q ss_pred EEECCCC-EEEEECCCCCCHHHHHHHHHHHH Q ss_conf 8873898-18998899978889999999871 Q gi|255764514|r 16 DIDFSAG-LSILSGDTGSGKSILLDALILVT 45 (554) Q Consensus 16 ~i~f~~G-l~vItGetGaGKS~ildAl~~~l 45 (554) ++.++++ +.+|||||.+|||+++.++.++. T Consensus 23 di~l~~~~~~iiTGpN~sGKSt~lkti~l~~ 53 (202) T cd03243 23 DINLGSGRLLLITGPNMGGKSTYLRSIGLAV 53 (202) T ss_pred EEEECCCCEEEEECCCCCCHHHHHHHHHHHH T ss_conf 2886798289998998875399999999999 No 499 >COG1127 Ttg2A ABC-type transport system involved in resistance to organic solvents, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Probab=97.02 E-value=0.0059 Score=38.44 Aligned_cols=73 Identities=30% Similarity=0.386 Sum_probs=55.0 Q ss_pred HCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHC--CCEEEEEC-HHHHHHHCCCEEEEEE Q ss_conf 06215799999999984366899769980344688879999999999997305--93999808-3798650176179999 Q gi|255764514|r 428 ASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSKK--IQLLAVTH-APQVAARADRHFLVYK 504 (554) Q Consensus 428 aSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~~--~Qvi~ITH-~pqvAa~a~~h~~v~K 504 (554) +|||=.=|++||=..++ +| +.++|||-.+|++--++..+-+++++|-+. .-+|+||| ++-+...+|+-+.+.. T Consensus 146 LSGGM~KRvaLARAial---dP-ell~~DEPtsGLDPI~a~~~~~LI~~L~~~lg~T~i~VTHDl~s~~~i~Drv~~L~~ 221 (263) T COG1127 146 LSGGMRKRVALARAIAL---DP-ELLFLDEPTSGLDPISAGVIDELIRELNDALGLTVIMVTHDLDSLLTIADRVAVLAD 221 (263) T ss_pred HCCHHHHHHHHHHHHHC---CC-CEEEECCCCCCCCCCHHHHHHHHHHHHHHHHCCEEEEEECCHHHHHHHHCEEEEEEC T ss_conf 04358899999999864---98-779855997788830277999999999986398799997771788733126899768 No 500 >PRK13545 tagH teichoic acids export protein ATP-binding subunit; Provisional Probab=97.02 E-value=0.001 Score=43.49 Aligned_cols=36 Identities=22% Similarity=0.348 Sum_probs=0.0 Q ss_pred ECCEEEEEEEEECCCC-EEEEECCCCCCHHHHHHHHH Q ss_conf 4227899998873898-18998899978889999999 Q gi|255764514|r 7 YNIVLIESLDIDFSAG-LSILSGDTGSGKSILLDALI 42 (554) Q Consensus 7 ~Nf~~i~~~~i~f~~G-l~vItGetGaGKS~ildAl~ 42 (554) +.|--.++++++..+| ...|.|+||||||+|+..|+ T Consensus 35 ~~f~ALknVSFeV~kGE~vGIIG~NGAGKSTLLKiIa 71 (549) T PRK13545 35 EYHYALNNISFEVPEGEIVGIVGLNGSGKSTLSNLIA 71 (549) T ss_pred CEEEEECCCEEEECCCCEEEEECCCCCCHHHHHHHHH T ss_conf 5377340725786489899998899998999999996 Done!