>TIGR00963 secA preprotein translocase, SecA subunit; InterPro: IPR000185 Secretion across the inner membrane in some Gram-negative bacteria occurs via the preprotein translocase pathway. Proteins are produced in the cytoplasm as precursors, and require a chaperone subunit to direct them to the translocase component. . From there, the mature proteins are either targeted to the outer membrane, or remain as periplasmic proteins. The translocase protein subunits are encoded on the bacterial chromosome. The translocase itself comprises 7 proteins, including a chaperone protein (SecB), an ATPase (SecA), an integral membrane complex (SecCY, SecE and SecG), and two additional membrane proteins that promote the release of the mature peptide into the periplasm (SecD and SecF) . The chaperone protein SecB is a highly acidic homotetrameric protein that exists as a "dimer of dimers" in the bacterial cytoplasm. SecB maintains preproteins in an unfolded state after translation, and targets these to the peripheral membrane protein ATPase SecA for secretion . SecA is a cytoplasmic protein of 800 to 960 amino acid residues. Homologs of secA are also encoded in the chloroplast genome of some algae as well as in the nuclear genome of plants . It could be involved in the intraorganellar protein transport into thylakoids.; GO: 0005524 ATP binding, 0006605 protein targeting, 0006886 intracellular protein transport.

Probab=97.69 E-value=0.0019 Score=39.07 Aligned_cols=124 Identities=22% Similarity=0.369 Sum_probs=76.7 Q ss_pred CCCCHHHHHHHHHHHHCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCH---HHHHHHHHHHHHHCCCCCCEE Q ss_conf 98747899999999967980999588998689999999999975999499991604---656999999998558888159 Q gi|255764515|r 1 MNLAPHQTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAPLR---VAQSVWTSEVQRWSNFSHMNI 77 (458) Q Consensus 1 ~~L~p~Q~~~v~~~~~~~~~ll~~~~G~GKT~~al~~~~~l~~~~~~~~LIv~P~~---l~~~~W~~Ei~kf~~~~~~~~ 77 (458) T Consensus 57 lG~r~fDVQliGg~~LH~G~IAEMkTGEGKTL~AtLp-aYLNAL~GkGVHvVTVNdYLA~RD~e~m~~v~~FL---GL~V 132 (904) T TIGR00963 57 LGLRPFDVQLIGGIVLHKGKIAEMKTGEGKTLVATLP-AYLNALTGKGVHVVTVNDYLARRDAEWMGQVYRFL---GLSV 132 (904) T ss_pred HCCCCHHHHHHHHHHHCCCCEEEECCCCCHHHHHHHH-HHHHHHCCCCCEEEEECCHHHHHHHHHHHHHHHHC---CCEE T ss_conf 3785618999999998089667831488628999999-99876517962799635044488899878999684---9368 Q ss_pred EEEEC--CHHHHHHHHCCCCCEEEECCCC-HHHHHHHC------CCCCCCCEEECCCCCCC Q ss_conf 99858--9789888730779869980642-02334420------00113220440453100 Q gi|255764515|r 78 SVITG--TVKQRTKVLKTPAVLYVINFEN-LGWLVQEL------KGTWPFATIVVDESTKL 129 (458) Q Consensus 78 ~~~~g--~~~~r~~~~~~~~~i~i~s~e~-~~~~~~~~------~~~~~~~~iIiDEaH~l 129 (458) T Consensus 133 Gl~~~~m~~~eRr~aY~cD-ITY~TNnELGFDYLRDNM~~~~ee~vqR~f~FAIIDEVDSI 192 (904) T TIGR00963 133 GLILSSMSPEERREAYACD-ITYGTNNELGFDYLRDNMALSKEEKVQRPFNFAIIDEVDSI 192 (904) T ss_pred EEECCCCCHHHHHHHHCCC-EEEECCCCCCHHHHHHHHHCCHHHHHCCCCCCEEEEEECCE T ss_conf 8861799858999985498-16532654202466676411501210167222688642446

HHsearch alignment for GI: 255764515 and conserved domain: TIGR00963