RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|255764516|ref|YP_003084344.1| hypothetical protein CLIBASIA_05532 [Candidatus Liberibacter asiaticus str. psy62] (341 letters) >gnl|CDD|144408 pfam00798, Arena_glycoprot, Arenavirus glycoprotein. Length = 473 Score = 30.3 bits (69), Expect = 0.80 Identities = 14/41 (34%), Positives = 23/41 (56%), Gaps = 6/41 (14%) Query: 76 LRIFEGEKQTFKDFNIEVQKKVNQVNVLTQKMNTIDGIVND 116 LR+F+ K K N E + N +N+LT TI+ +++D Sbjct: 301 LRLFDFNKNAIKTLNDETK---NALNLLT---KTINSLISD 335 >gnl|CDD|36362 KOG1147, KOG1147, KOG1147, Glutamyl-tRNA synthetase [Translation, ribosomal structure and biogenesis]. Length = 712 Score = 27.6 bits (61), Expect = 5.1 Identities = 17/72 (23%), Positives = 32/72 (44%), Gaps = 2/72 (2%) Query: 27 VKDPSRIHAEV-KYPDGNMEELSPERDFKVDVDESSLILSSKRWINNNNALRIFEGEKQT 85 V R+ + P E+SP+ ++ E +I S K + +A + EGE+ T Sbjct: 513 VVKEDRVEVTITNGPQEEYIEVSPKHKKNPELGEKKVIYSKKILLEQADAEALKEGEEVT 572 Query: 86 FKDF-NIEVQKK 96 ++ N ++K Sbjct: 573 LMNWGNAIIKKI 584 >gnl|CDD|35737 KOG0517, KOG0517, KOG0517, Beta-spectrin [Cytoskeleton]. Length = 2473 Score = 27.6 bits (61), Expect = 5.6 Identities = 18/68 (26%), Positives = 35/68 (51%), Gaps = 5/68 (7%) Query: 93 VQKKVNQVNVLTQKMNTIDGIVNDLAIQTEDVGRKLEQIDLSKVEGLDPQ---TRKYLQD 149 V +K ++ +K+ + ++L T++ GRKL Q ++ E L +K L + Sbjct: 1336 VSEKPELKALVEKKLRELHKQWDELEKTTQEKGRKLFQA--NRQELLLQSLADAKKKLDE 1393 Query: 150 IQTQLTSD 157 +++QL SD Sbjct: 1394 LESQLQSD 1401 >gnl|CDD|144066 pfam00334, NDK, Nucleoside diphosphate kinase. Length = 135 Score = 27.4 bits (62), Expect = 6.4 Identities = 8/21 (38%), Positives = 11/21 (52%), Gaps = 1/21 (4%) Query: 306 MAVSAENARKRWR-IMGKTDS 325 M + ENA R +MG T+ Sbjct: 72 MVLEGENAVAVVRELMGATNP 92 >gnl|CDD|133192 cd05061, PTKc_InsR, Catalytic domain of the Protein Tyrosine Kinase, Insulin Receptor. Protein Tyrosine Kinase (PTK) family; Insulin Receptor (InsR); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. InsR is a receptor tyr kinase (RTK) that is composed of two alphabeta heterodimers. Binding of the insulin ligand to the extracellular alpha subunit activates the intracellular tyr kinase domain of the transmembrane beta subunit. Receptor activation leads to autophosphorylation, stimulating downstream kinase activities, which initiate signaling cascades and biological function. InsR signaling plays an important role in many cellular processes including glucose homeostasis, glycogen synthesis, lipid and protein metabolism, ion and amino acid transport, cell cycle and proliferation, cell differentiation, gene transcription, and nitric oxide synthesis. Insulin resistance, caused by abnormalities in InsR signaling, has been described in diabetes, hypertension, cardiovascular disease, metabolic syndrome, heart failure, and female infertility. Length = 288 Score = 26.9 bits (59), Expect = 8.0 Identities = 12/33 (36%), Positives = 22/33 (66%), Gaps = 1/33 (3%) Query: 194 VVKGDI-TGLSIATKNKSGSLENRIKFYDDKDV 225 ++KG+ T +++ T N+S SL RI+F ++ V Sbjct: 30 IIKGEAETRVAVKTVNESASLRERIEFLNEASV 62 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.316 0.133 0.379 Gapped Lambda K H 0.267 0.0723 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 3,931,247 Number of extensions: 196854 Number of successful extensions: 445 Number of sequences better than 10.0: 1 Number of HSP's gapped: 445 Number of HSP's successfully gapped: 11 Length of query: 341 Length of database: 6,263,737 Length adjustment: 94 Effective length of query: 247 Effective length of database: 4,232,491 Effective search space: 1045425277 Effective search space used: 1045425277 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 58 (26.1 bits)