RPS-BLAST 2.2.22 [Sep-27-2009] Database: mmdb70 33,805 sequences; 4,956,049 total letters Searching..................................................done Query= gi|255764516|ref|YP_003084344.1| hypothetical protein CLIBASIA_05532 [Candidatus Liberibacter asiaticus str. psy62] (341 letters) >3fho_A ATP-dependent RNA helicase DBP5; mRNA export, ATPase, translation termination, ATP-binding, cytoplasm, hydrolase, membrane; 2.80A {Schizosaccharomyces pombe} (A:1-326) Length = 326 Score = 29.7 bits (66), Expect = 0.48 Identities = 17/90 (18%), Positives = 34/90 (37%), Gaps = 16/90 (17%) Query: 86 FKDFNIEVQKKVNQVNVLTQKMNTIDGIVNDLAIQTEDVGRKLEQI------DLSKVEGL 139 KD + K Q+ + T G V DL + + R ++ ++ +GL Sbjct: 224 IKDSVPKGAKIDAQIVIGT------PGTVMDLMKRRQLDARDIKVFVLDEADNMLDQQGL 277 Query: 140 DPQTRKYLQ----DIQTQLTSDTLTLQLDD 165 Q+ + + Q L S T + +++ Sbjct: 278 GDQSMRIKHLLPRNTQIVLFSATFSERVEK 307 >2hhp_A Poly(A) polymerase; template-independent RNA polymerase, transferase; HET: FLC; 1.80A {Saccharomyces cerevisiae} (A:1-39,A:202-349) Length = 187 Score = 28.7 bits (64), Expect = 1.2 Identities = 17/74 (22%), Positives = 28/74 (37%), Gaps = 11/74 (14%) Query: 247 QLTPRFLGLLQGRTMVRSANLREKASIGDIITGDKIAYWAYPSENSSGYISASATQEHTM 306 L P G LQ R ++++ +IT AYPS ++ I+ S T Sbjct: 111 ILKPIEDGPLQVRVWNPKIYAQDRSHRMPVIT------PAYPSMCATHNITES-----TK 159 Query: 307 AVSAENARKRWRIM 320 V + + +I Sbjct: 160 KVILQEFVRGVQIT 173 >3eu8_A Putative glucoamylase; YP_210071.1, structural genomics, joint center for structural genomics, JCSG, protein structure initiative; 2.12A {Bacteroides fragilis nctc 9343} (A:1-225,A:338-425) Length = 313 Score = 27.1 bits (60), Expect = 3.7 Identities = 15/57 (26%), Positives = 19/57 (33%), Gaps = 5/57 (8%) Query: 212 SLENRIKFYDDKDVYINGQCFVKGTDTSIFDEIARQLTPRFLGLLQGRTMVRSANLR 268 SL+ Y+ D F F E A R+L + QG V N R Sbjct: 240 SLQVXHHLYEXGDKVFGPYGFYDA-----FSETADWYPKRYLAIDQGPIAVXIENYR 291 >3i10_A Putative glycerophosphoryl diester phosphodiesterase; NP_812074.1, structural genomics; HET: MSE; 1.35A {Bacteroides thetaiotaomicron vpi-5482} (A:1-65,A:105-278) Length = 239 Score = 26.9 bits (59), Expect = 4.2 Identities = 2/37 (5%), Positives = 10/37 (27%) Query: 22 VIPWTVKDPSRIHAEVKYPDGNMEELSPERDFKVDVD 58 + T+ + + + E+ ++ Sbjct: 182 IWYNTLWGSLAGNHDDNLALTDPEKSYGYLIEQLGAR 218 >1kaf_A Transcription regulatory protein MOTA; escherichia coli, X-RAY crystallography, protein-DNA interactions, structural genomics; 1.60A {Enterobacteria phage T4} (A:) Length = 108 Score = 26.4 bits (58), Expect = 5.6 Identities = 12/34 (35%), Positives = 15/34 (44%), Gaps = 5/34 (14%) Query: 70 INNNNALRIF-----EGEKQTFKDFNIEVQKKVN 98 INNN +RIF E Q F D + + N Sbjct: 51 INNNGNMRIFGYKMMEHHIQKFTDIGMSCKIAKN 84 >1iyk_A Myristoyl-COA:protein N-myristoyltransferase; HET: MYA MIM; 2.30A {Candida albicans} (A:) Length = 392 Score = 25.5 bits (56), Expect = 9.5 Identities = 17/72 (23%), Positives = 34/72 (47%), Gaps = 6/72 (8%) Query: 17 FGSYFVIPWTVKDPSRIHAEVK--YPDGNMEELSPERDFKVDVDE---SSLILSSKRWIN 71 + SY+++P+TV D + H E+ Y + + ++K ++E +LI S K ++ Sbjct: 272 YFSYYLLPFTVLD-NAQHDELGIAYLFYYASDSFEKPNYKKRLNELITDALITSKKFGVD 330 Query: 72 NNNALRIFEGEK 83 N L + Sbjct: 331 VFNCLTCQDNTY 342 Database: mmdb70 Posted date: Jun 20, 2010 3:12 AM Number of letters in database: 4,956,049 Number of sequences in database: 33,805 Lambda K H 0.316 0.133 0.379 Gapped Lambda K H 0.267 0.0536 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 33805 Number of Hits to DB: 2,514,501 Number of extensions: 109746 Number of successful extensions: 332 Number of sequences better than 10.0: 1 Number of HSP's gapped: 332 Number of HSP's successfully gapped: 17 Length of query: 341 Length of database: 4,956,049 Length adjustment: 89 Effective length of query: 252 Effective length of database: 1,947,404 Effective search space: 490745808 Effective search space used: 490745808 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 55 (25.4 bits)