RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|255764517|ref|YP_003084345.1| hypothetical protein CLIBASIA_05538 [Candidatus Liberibacter asiaticus str. psy62] (135 letters) >gnl|CDD|36242 KOG1024, KOG1024, KOG1024, Receptor-like protein tyrosine kinase RYK/derailed [Signal transduction mechanisms]. Length = 563 Score = 25.7 bits (56), Expect = 3.6 Identities = 13/46 (28%), Positives = 21/46 (45%), Gaps = 6/46 (13%) Query: 47 DGRVQELAISQDFDVDGLNALLTVNNREGDFIRIFEGEKQTFKEYN 92 + R+QEL + + L+ +EG F RI+ G + YN Sbjct: 273 NRRLQELTVQRC------RVRLSCLLQEGTFGRIYRGIWREEDTYN 312 >gnl|CDD|145050 pfam01696, Adeno_E1B_55K, Adenovirus EB1 55K protein / large t-antigen. This family consists of adenovirus E1B 55K protein or large t-antigen. E1B 55K binds p53 the tumour suppressor protein converting it from a transcriptional activator which responds to damaged DNA in to an unregulated repressor of genes with a p53 binding site. This protects the virus against p53 induced host antiviral responses and prevents apoptosis as induced by the adenovirus E1A protein. The E1B region of adenovirus encodes two proteins E1B 55K the large t-antigen as found in this family and E1B 19K pfam01691 the small t-antigen which is not found in this family; both of these proteins inhibit E1A induced apoptosis. Length = 387 Score = 25.7 bits (57), Expect = 4.2 Identities = 15/48 (31%), Positives = 23/48 (47%), Gaps = 9/48 (18%) Query: 7 MEKLNFEQTKSVTYWAVGSKFVIPW-DIKDPSRIHAEVGYSDGRVQEL 53 +EK +FEQ K TYW P D+++ R HA+V + + Sbjct: 39 LEKYSFEQIK--TYWLE------PGDDLEEAIRQHAKVALRPDKEYVI 78 >gnl|CDD|38581 KOG3371, KOG3371, KOG3371, Uncharacterized conserved protein [Function unknown]. Length = 243 Score = 25.3 bits (55), Expect = 4.8 Identities = 14/54 (25%), Positives = 21/54 (38%), Gaps = 10/54 (18%) Query: 31 WDIKDPSRIHAEVGYSDGRVQELAISQDFDVDGLNALLTVNNREGDFIRIFEGE 84 W + D +H E G+ + + D + AL TV N + I EG Sbjct: 133 WSLDDKDPMHVENGF-------ITLKPD-KMTRSVALTTVMNTG--LVEIEEGT 176 >gnl|CDD|34711 COG5108, RPO41, Mitochondrial DNA-directed RNA polymerase [Transcription]. Length = 1117 Score = 25.4 bits (55), Expect = 5.3 Identities = 10/47 (21%), Positives = 15/47 (31%) Query: 73 REGDFIRIFEGEKQTFKEYNSDSPRAPHNLVKEADLYPLHNRLDGVE 119 E + EK +++ P HN V H + G E Sbjct: 376 DEFFSEQFKGHEKDAYEDARKKIPEQFHNAVHNKRSMTRHAKHKGAE 422 >gnl|CDD|32605 COG2706, COG2706, 3-carboxymuconate cyclase [Carbohydrate transport and metabolism]. Length = 346 Score = 24.8 bits (54), Expect = 6.6 Identities = 10/30 (33%), Positives = 18/30 (60%) Query: 58 DFDVDGLNALLTVNNREGDFIRIFEGEKQT 87 DF+++ L N++ D I +FE +K+T Sbjct: 295 DFNINPSGRFLIAANQKSDNITVFERDKET 324 >gnl|CDD|38114 KOG2903, KOG2903, KOG2903, Predicted glutathione S-transferase [Posttranslational modification, protein turnover, chaperones]. Length = 319 Score = 24.9 bits (54), Expect = 7.0 Identities = 19/61 (31%), Positives = 27/61 (44%), Gaps = 12/61 (19%) Query: 70 VNNREGDFIRIFEGEKQTFKEYNSDSPRAPHNLVKEADLYP--LHNRLDGVETIVSD-LN 126 VNN + IR+F F E+N + DLYP L ++D + V D +N Sbjct: 136 VNNESSEIIRMF---NSAFDEFNGIAEN------PVLDLYPSSLRAQIDETNSWVYDKIN 186 Query: 127 N 127 N Sbjct: 187 N 187 >gnl|CDD|144408 pfam00798, Arena_glycoprot, Arenavirus glycoprotein. Length = 473 Score = 24.9 bits (55), Expect = 7.9 Identities = 14/60 (23%), Positives = 30/60 (50%), Gaps = 12/60 (20%) Query: 76 DFIRIFEGEKQTFKEYNSDSPRAPHNLVKEADLYPLHNRLDGVETIVSDLNNMKNRIQDL 135 D +R+F+ K K N ++ + NL+ + + +++SD MKN++++L Sbjct: 299 DMLRLFDFNKNAIKTLNDET-KNALNLLTKT-----------INSLISDNLLMKNKLREL 346 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.317 0.135 0.394 Gapped Lambda K H 0.267 0.0737 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 1,580,016 Number of extensions: 73659 Number of successful extensions: 143 Number of sequences better than 10.0: 1 Number of HSP's gapped: 143 Number of HSP's successfully gapped: 16 Length of query: 135 Length of database: 6,263,737 Length adjustment: 84 Effective length of query: 51 Effective length of database: 4,448,581 Effective search space: 226877631 Effective search space used: 226877631 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 52 (23.8 bits)