RPS-BLAST 2.2.22 [Sep-27-2009] Database: mmdb70 33,805 sequences; 4,956,049 total letters Searching..................................................done Query= gi|255764517|ref|YP_003084345.1| hypothetical protein CLIBASIA_05538 [Candidatus Liberibacter asiaticus str. psy62] (135 letters) >3fe3_A MAP/microtubule affinity-regulating kinase 3; serine/threonine protein kinase, MARK;PAR-1, UBA domain;C-TAK1;P78;MARK3, alternative splicing; 1.90A {Homo sapiens} PDB: 2qnj_A 1y8g_A* 1zmw_A 1zmu_A 1zmv_A 2r0i_A 2hak_A 3iec_A (A:1-95,A:269-328) Length = 155 Score = 24.9 bits (54), Expect = 3.9 Identities = 12/33 (36%), Positives = 14/33 (42%), Gaps = 2/33 (6%) Query: 30 PWDIKDPSRIHAEV--GYSDGRVQELAISQDFD 60 DI D RI V GYS +QE +D Sbjct: 111 ELDISDQKRIDIMVGMGYSQEEIQESLSKMKYD 143 >1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} (A:) Length = 267 Score = 24.6 bits (51), Expect = 5.2 Identities = 3/28 (10%), Positives = 9/28 (32%) Query: 31 WDIKDPSRIHAEVGYSDGRVQELAISQD 58 D+ + + R+ + I+ Sbjct: 234 MDLAISKEMDTFHPHKQTRLYGITIALS 261 >1r9d_A Glycerol dehydratase; radical SAM, lyase; 1.80A {Clostridium butyricum} (A:24-128,A:168-278) Length = 216 Score = 24.3 bits (53), Expect = 6.7 Identities = 13/49 (26%), Positives = 20/49 (40%), Gaps = 1/49 (2%) Query: 43 VGYSDGRVQELAISQDFDVDGLNALL-TVNNREGDFIRIFEGEKQTFKE 90 VG + + +F L L +N R GD +I E K+ K+ Sbjct: 50 VGSLTKEPRSSQVFPEFSNKWLQDELDRLNKRTGDAFQISEESKEKLKD 98 >1u7i_A Hypothetical protein; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.40A {Pseudomonas aeruginosa PAO1} (A:1-75) Length = 75 Score = 23.9 bits (52), Expect = 7.7 Identities = 7/46 (15%), Positives = 12/46 (26%), Gaps = 5/46 (10%) Query: 79 RIFEGEKQTFKEYNSDSPRAPHNLVKEADLYPLHNRLDGVETIVSD 124 +F+ + + P V +A RL D Sbjct: 27 SLFDDAEILQIQRYGAEGPGPEGSVLKALF-----RLGDQSVHCID 67 Database: mmdb70 Posted date: Jun 20, 2010 3:12 AM Number of letters in database: 4,956,049 Number of sequences in database: 33,805 Lambda K H 0.317 0.135 0.394 Gapped Lambda K H 0.267 0.0565 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 33805 Number of Hits to DB: 1,001,385 Number of extensions: 40918 Number of successful extensions: 71 Number of sequences better than 10.0: 1 Number of HSP's gapped: 71 Number of HSP's successfully gapped: 9 Length of query: 135 Length of database: 4,956,049 Length adjustment: 79 Effective length of query: 56 Effective length of database: 2,285,454 Effective search space: 127985424 Effective search space used: 127985424 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.4 bits)