Query         537021.9.peg.1064_1
Match_columns 238
No_of_seqs    20 out of 22
Neff          3.3 
Searched_HMMs 33803
Date          Wed May 25 05:06:20 2011
Command       /home/congqian_1/programs/hhpred/hhsearch -i peg_1064.hhm -d /home/congqian_1/database/mmdb/mmdb70.hhm 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 >1z1b_A Integrase; protein-DNA  37.2      19 0.00057   15.8   1.9   26   44-69     15-40  (59)
  2 >2v51_E MKL/myocardin-like pro  35.6      17 0.00051   16.1   1.4   12  174-185    18-29  (32)
  3 >3e19_A FEOA; transcriptional   17.7      54  0.0016   12.9   1.3   18  170-187    24-41  (77)
  4 >3i0u_A Phosphothreonine lyase  16.4      62  0.0018   12.6   2.0   43  140-186   131-173 (218)
  5 >2k5i_A Iron transport protein  15.9      57  0.0017   12.8   1.0   16  172-187    22-37  (75)
  6 >3bo6_A Hydrophilic protein, V  15.7      65  0.0019   12.5   2.0   40  143-186   136-175 (220)
  7 >2p1w_A 27.5 kDa virulence pro  14.4      70  0.0021   12.2   2.0   20  167-186   186-205 (250)
  8 >2h3j_A Hypothetical protein P  14.1      69   0.002   12.3   1.0   17  171-187    21-37  (75)
  9 >2k5f_A Ferrous iron transport  13.1      76  0.0022   12.0   1.4   17  171-187    21-37  (105)
 10 >2h12_A Citrate synthase; acid  12.8      69   0.002   12.3   0.7   20   54-73     12-31  (51)

No 1  
>>1z1b_A Integrase; protein-DNA complex, DNA binding protein/DNA complex; HET: PTR; 3.80A {Enterobacteria phage lambda} (A:1-59)
Probab=37.24  E-value=19  Score=15.76  Aligned_cols=26  Identities=15%  Similarity=0.125  Sum_probs=17.9

Q ss_pred             CEEEEECCCCEEECCCCCCEEECCCC
Q ss_conf             13688659840325667732213542
Q 537021.9.peg.1   44 IWQYKTSGVDKIIDSFIGREISIPHY   69 (238)
Q Consensus        44 sltYsq~g~~~~~Dp~tGk~y~~P~~   69 (238)
                      +|--+..+.=.|.+|.|||++.+-+-
T Consensus        15 NLy~k~~kY~~Yr~P~tGk~~~LG~d   40 (59)
T 1z1b_A           15 NLYIRNNGYYCYRDPRTGKEFGLGRD   40 (59)
T ss_dssp             TEEEETTTEEEEECTTTCCEEEEESC
T ss_pred             CEEECCCEEEEEEECCCCEEEECCCC
T ss_conf             58973998999997899979868899


No 2  
>>2v51_E MKL/myocardin-like protein 1; structural protein/contractIle protein, contractIle protein, structural protein, nucleotide-binding; HET: ATP LAB; 2.35A {Mus musculus} (E:)
Probab=35.58  E-value=17  Score=16.09  Aligned_cols=12  Identities=25%  Similarity=0.470  Sum_probs=9.3

Q ss_pred             HHHHHHHCCCCC
Q ss_conf             999876067657
Q 537021.9.peg.1  174 ETKLHNQGLVSG  185 (238)
Q Consensus       174 etrLaNQGl~~G  185 (238)
                      +.+|+||||.|-
T Consensus        18 reql~~qgi~pp   29 (32)
T 2v51_E           18 REELVSQGIMPP   29 (32)
T ss_dssp             HHHHHHTTSSCC
T ss_pred             HHHHHHCCCCCC
T ss_conf             999987457887


No 3  
>>3e19_A FEOA; transcriptional regulator, metal-binding, iron uptake, beta- barrel, transcription regulator, metal binding protein; HET: GOL; 2.00A {Thermococcus thioreducens} (A:)
Probab=17.73  E-value=54  Score=12.94  Aligned_cols=18  Identities=28%  Similarity=0.457  Sum_probs=13.6

Q ss_pred             HHHHHHHHHHHCCCCCHH
Q ss_conf             999999987606765758
Q 537021.9.peg.1  170 REDLETKLHNQGLVSGSV  187 (238)
Q Consensus       170 r~aLetrLaNQGl~~GS~  187 (238)
                      -..+..||..-||.||++
T Consensus        24 ~~~~~~rL~~lGi~~G~~   41 (77)
T 3e19_A           24 GHNARQKLVSMGLTPGAT   41 (77)
T ss_dssp             HHHHHHHHHTTTCSTTCE
T ss_pred             CHHHHHHHHHCCCCCCCE
T ss_conf             989999999779999989


No 4  
>>3i0u_A Phosphothreonine lyase OSPF; APO-structure, type III effector, plasmid, secreted, virulence, structural genomics; 2.70A {Shigella flexneri} (A:)
Probab=16.41  E-value=62  Score=12.58  Aligned_cols=43  Identities=23%  Similarity=0.296  Sum_probs=27.1

Q ss_pred             CCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCH
Q ss_conf             03331100234677999999862079875799999998760676575
Q 537021.9.peg.1  140 KEILYNYPTMGSQQYEKAFLDRLQSSLQQDREDLETKLHNQGLVSGS  186 (238)
Q Consensus       140 g~i~~~y~~~~~q~~~~al~~rl~pq~~~~r~aLetrLaNQGl~~GS  186 (238)
                      .=.+|-+++..-..|-..+|--    +..=-+.||.+|.-.||.||.
T Consensus       131 QfTLY~kpd~~ds~Ysa~~l~k----~r~fi~~lE~~L~~aGi~pg~  173 (218)
T 3i0u_A          131 QFTLYVKSDQECSQYSALLLHK----IRQFIMCLESNLLRSKIAPGE  173 (218)
T ss_dssp             CEEEEEECCSSTTCCCHHHHHH----HHHHHHHHHHHHHHTTCCBCC
T ss_pred             EEEEEECCCCCCCCCCHHHHHH----HHHHHHHHHHHHHHCCCCCCC
T ss_conf             4899846875566456999987----899999999999972678898


No 5  
>>2k5i_A Iron transport protein; iron(II) transport protein A, FEOA, , structural genomic, structural genomics, PSI-2; NMR {Clostridium thermocellum} (A:1-75)
Probab=15.90  E-value=57  Score=12.78  Aligned_cols=16  Identities=38%  Similarity=0.603  Sum_probs=11.6

Q ss_pred             HHHHHHHHHCCCCCHH
Q ss_conf             9999987606765758
Q 537021.9.peg.1  172 DLETKLHNQGLVSGSV  187 (238)
Q Consensus       172 aLetrLaNQGl~~GS~  187 (238)
                      .+..||..-||.||++
T Consensus        22 ~~~~rL~~lGl~~G~~   37 (75)
T 2k5i_A           22 ELHEKLVGMGFVPGEE   37 (75)
T ss_dssp             SHHHHHHHHTCCTTCE
T ss_pred             HHHHHHHHCCCCCCCE
T ss_conf             9999999779999989


No 6  
>>3bo6_A Hydrophilic protein, VIRA protein; alpha/beta fold of phosphothreonine lyase; 1.40A {Chromobacterium violaceum} PDB: 2z8n_A 2z8m_A 2z8o_A* 2z8p_A* 2q8y_A* (A:)
Probab=15.69  E-value=65  Score=12.46  Aligned_cols=40  Identities=35%  Similarity=0.507  Sum_probs=22.8

Q ss_pred             CCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCH
Q ss_conf             31100234677999999862079875799999998760676575
Q 537021.9.peg.1  143 LYNYPTMGSQQYEKAFLDRLQSSLQQDREDLETKLHNQGLVSGS  186 (238)
Q Consensus       143 ~~~y~~~~~q~~~~al~~rl~pq~~~~r~aLetrLaNQGl~~GS  186 (238)
                      +|--++..-+.|-...|.    .+..=-+.||.+|.-.||.||.
T Consensus       136 LY~KPd~eds~Ys~~~l~----k~r~fi~~lE~~L~~aGi~pg~  175 (220)
T 3bo6_A          136 LYVKPDQENSQYSASSLH----NTRQFIECLESRLSESGLMPGQ  175 (220)
T ss_dssp             EECCCSSTTSCCCHHHHH----HHHHHHHHHHHHHHHTTCCBCC
T ss_pred             EEECCCCCCCCCCHHHHH----HHHHHHHHHHHHHHHCCCCCCC
T ss_conf             985687445668989998----8999999999999973788888


No 7  
>>2p1w_A 27.5 kDa virulence protein; beta sheet- alpha helix, lyase; 2.30A {Salmonella enteritidis} (A:)
Probab=14.41  E-value=70  Score=12.25  Aligned_cols=20  Identities=40%  Similarity=0.590  Sum_probs=15.9

Q ss_pred             HHHHHHHHHHHHHHCCCCCH
Q ss_conf             75799999998760676575
Q 537021.9.peg.1  167 QQDREDLETKLHNQGLVSGS  186 (238)
Q Consensus       167 ~~~r~aLetrLaNQGl~~GS  186 (238)
                      .+=-+.||.+|.-.||.||-
T Consensus       186 r~fi~~lE~~L~~aGi~pg~  205 (250)
T 2p1w_A          186 RQFIECLESRLSENGVISGQ  205 (250)
T ss_dssp             HHHHHHHHHHHHHTTCCBCC
T ss_pred             HHHHHHHHHHHHHCCCCCCC
T ss_conf             99999999999972788898


No 8  
>>2h3j_A Hypothetical protein PA4359; NESG, GFT structural genomics, PAT89, PSI-2, protein structure initiative; NMR {Pseudomonas aeruginosa} (A:)
Probab=14.06  E-value=69  Score=12.29  Aligned_cols=17  Identities=24%  Similarity=0.559  Sum_probs=12.0

Q ss_pred             HHHHHHHHHHCCCCCHH
Q ss_conf             99999987606765758
Q 537021.9.peg.1  171 EDLETKLHNQGLVSGSV  187 (238)
Q Consensus       171 ~aLetrLaNQGl~~GS~  187 (238)
                      ..+..||..-||.||++
T Consensus        21 ~~~~~rL~~lGi~~G~~   37 (75)
T 2h3j_A           21 NGYRQRLFSMGLLPGAA   37 (75)
T ss_dssp             TTHHHHHHHHTCCTTCE
T ss_pred             HHHHHHHHHCCCCCCCE
T ss_conf             99999999759999989


No 9  
>>2k5f_A Ferrous iron transport protein A; SH3-like, alpha+beta, GFT, structural genomics, PSI-2, protein structure initiative; NMR {Chlorobaculum tepidum} (A:)
Probab=13.08  E-value=76  Score=12.01  Aligned_cols=17  Identities=29%  Similarity=0.530  Sum_probs=10.9

Q ss_pred             HHHHHHHHHHCCCCCHH
Q ss_conf             99999987606765758
Q 537021.9.peg.1  171 EDLETKLHNQGLVSGSV  187 (238)
Q Consensus       171 ~aLetrLaNQGl~~GS~  187 (238)
                      ..+..||..-||.||+.
T Consensus        21 ~~~~~rL~~lGi~~G~~   37 (105)
T 2k5f_A           21 PAVRRRLMDLGLVRGAK   37 (105)
T ss_dssp             HHHHHHHHHHTCSTTCE
T ss_pred             CHHHHHHHHCCCCCCCE
T ss_conf             57999999789999989


No 10 
>>2h12_A Citrate synthase; acidophIle, acetic acid resistance, allostery, transferase; HET: CMX; 1.85A {Acetobacter aceti} (A:1-51)
Probab=12.76  E-value=69  Score=12.30  Aligned_cols=20  Identities=15%  Similarity=0.149  Sum_probs=15.4

Q ss_pred             EEECCCCCCEEECCCCCCCC
Q ss_conf             03256677322135421012
Q 537021.9.peg.1   54 KIIDSFIGREISIPHYLQSY   73 (238)
Q Consensus        54 ~~~Dp~tGk~y~~P~~tatq   73 (238)
                      +-+.-+.||+|++|+...|-
T Consensus        12 ~a~L~~~g~~~elpv~~gT~   31 (51)
T 2h12_A           12 TATISVDGKSAEMPVLSGTL   31 (51)
T ss_dssp             EEEEEETTEEEEEEEECCSB
T ss_pred             EEEEEECCEEEEEEEEECCC
T ss_conf             69997899799854542788


Done!