BLAST/PSIBLAST alignment of GI: peg_1064 and GI: 319783503 at iteration 2
>gi|319783503|ref|YP_004142979.1| hypothetical protein Mesci_3812 [Mesorhizobium ciceri biovar biserrulae WSM1271] Length = 330
>gi|317169391|gb|ADV12929.1| hypothetical protein Mesci_3812 [Mesorhizobium ciceri biovar biserrulae WSM1271] Length = 330
 Score =  131 bits (328), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 47/219 (21%), Positives = 86/219 (39%), Gaps = 32/219 (14%)

Query: 13  KAIASLQLSANLANASANAYRENIDRMTPDGIWQYKTSGVDKIIDSFIGREISIPHYLQS 72
           K  ++   + N+  A ANA   N++++TPDG   Y  +G  K  D + G+   IP Y  +
Sbjct: 13  KETSAASTATNVGTAIANANLGNVNQVTPDGSLNYSQTGTYKWNDPYTGKSYDIPTYTAT 72

Query: 73  YSLHPIQQQIHNRQNINNLLLSDLLTQRIQDLLPHHHTHVNTTKDFPPQQLRDNDVPEKP 132
            +L    Q I ++ +   L L +L   +   L       V+ + D               
Sbjct: 73  QTLSGTGQAIKDQTDQAKLNLGELAAGQSSFLKDWLAKPVDLSND-------------AT 119

Query: 133 NASLEERKEILYNYPTMGSQQYEKAFLDRLQSSLQQDREDLETKLHNQGLVSGSVAWNRA 192
              L +                    + RLQ +L   R+  E  L N+G+  GS  + +A
Sbjct: 120 EGRLMDLG------------------MKRLQPALDARRQANEADLINRGIRPGSDNYAQA 161

Query: 193 IDETNRKLHDVRLAAMLKASDEQERLDNIQEKHAYFHNL 231
            +  ++  +D    ++L +   Q   + + +  A  +NL
Sbjct: 162 QNIQDQGENDA-YNSLLLSGRGQAVQEALAQNSAPINNL 199