RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= 537021.9.peg.1064_1 (238 letters) >gnl|CDD|182091 PRK09814, PRK09814, beta-1,6-galactofuranosyltransferase; Provisional. Length = 333 Score = 28.8 bits (65), Expect = 1.2 Identities = 8/31 (25%), Positives = 20/31 (64%) Query: 134 ASLEERKEILYNYPTMGSQQYEKAFLDRLQS 164 ASL+ +++ +PT ++++ F+D+L+ Sbjct: 60 ASLKPGDIVIFQFPTWNGFEFDRLFVDKLKK 90 >gnl|CDD|129792 TIGR00709, dat, 2,4-diaminobutyrate 4-transaminases. This family consists of L-diaminobutyric acid transaminases. This general designation covers both 2.6.1.76 (diaminobutyrate-2-oxoglutarate transaminase, which uses glutamate as the amino donor in DABA biosynthesis), and 2.6.1.46 (diaminobutyrate--pyruvate transaminase, which uses alanine as the amino donor). Most members with known function are 2.6.1.76, and at least some annotations as 2.6.1.46 in current databases at time of model revision are incorrect. A distinct branch of this family contains examples of 2.6.1.76 nearly all of which are involved in ectoine biosynthesis. A related enzyme is 4-aminobutyrate aminotransferase (EC 2.6.1.19), also called GABA transaminase. These enzymes all are pyridoxal phosphate-containing class III aminotransferase. Length = 442 Score = 28.4 bits (63), Expect = 1.6 Identities = 16/56 (28%), Positives = 29/56 (51%), Gaps = 2/56 (3%) Query: 151 SQQYEKAFLDRLQSSLQQDRE-DLETKLHNQGLVSGSVAWNRAIDETNRKLHDVRL 205 S +Y + F++ ++S + + LE G+V+ W + I E RK HD++L Sbjct: 189 SIEYFENFIEDVESGVDKPAAVILEAIQGEGGVVAAPSEWLQKIREVTRK-HDIKL 243 >gnl|CDD|119294 pfam10774, BssS, Biofilm regulator BssS. BssS (also known as YliH) regulates Escherichia coli K-12 biofilm formation through quorum sensing. BssS is also involved in motility regulation as it represses motility 7 fold by decreasing transcription of the flagella and motility loci. Length = 112 Score = 28.2 bits (63), Expect = 1.8 Identities = 12/35 (34%), Positives = 21/35 (60%) Query: 190 NRAIDETNRKLHDVRLAAMLKASDEQERLDNIQEK 224 + A E +R+L + L+A A + + RLD IQ++ Sbjct: 21 HSASSEADRQLVEALLSAHTSAVEGRRRLDAIQQE 55 >gnl|CDD|184289 PRK13737, PRK13737, conjugal transfer pilus assembly protein TraU; Provisional. Length = 330 Score = 27.8 bits (62), Expect = 2.8 Identities = 13/32 (40%), Positives = 19/32 (59%), Gaps = 1/32 (3%) Query: 162 LQSSLQQDREDLETKLHNQGLVSGSVAWNRAI 193 LQSSL E + KLH QG++ ++ N A+ Sbjct: 236 LQSSLLVS-ERMAFKLHRQGMIMETIGKNNAV 266 >gnl|CDD|161756 TIGR00194, uvrC, excinuclease ABC, C subunit. This family consists of the DNA repair enzyme UvrC, an ABC excinuclease subunit which interacts with the UvrA/UvrB complex to excise UV-damaged nucleotide segments. Length = 574 Score = 27.3 bits (61), Expect = 3.8 Identities = 12/48 (25%), Positives = 24/48 (50%), Gaps = 6/48 (12%) Query: 53 DKIIDSFIGREISIPHYLQSYSLHPIQQQIH-NRQNINNLLLSDLLTQ 99 D+++++F+ + Y Q Y I +I + + LL DLL++ Sbjct: 282 DELVETFLIQ-----FYQQGYQNRLIPSEILVSLSLEDLKLLEDLLSE 324 >gnl|CDD|185134 PRK15212, PRK15212, virulence protein SpvA; Provisional. Length = 255 Score = 27.1 bits (59), Expect = 4.7 Identities = 15/43 (34%), Positives = 25/43 (58%), Gaps = 1/43 (2%) Query: 70 LQSYSLHPIQQQIHNRQNINNLLL-SDLLTQRIQDLLPHHHTH 111 L S ++ IQ Q R ++ L++ +D + Q+I LLP+H H Sbjct: 97 LSSSAVGGIQGQAERRPDLATLMVVNDAINQQIPTLLPYHFPH 139 >gnl|CDD|184888 PRK14894, PRK14894, glycyl-tRNA synthetase; Provisional. Length = 539 Score = 26.9 bits (59), Expect = 4.9 Identities = 12/38 (31%), Positives = 21/38 (55%), Gaps = 1/38 (2%) Query: 119 PPQQLRDNDVPEKPNASLEERK-EILYNYPTMGSQQYE 155 P ++ DVP A +R +++Y+YP +G Q+ E Sbjct: 226 PRSRITIYDVPPDELAHYSKRTFDLMYDYPNIGVQEIE 263 >gnl|CDD|184064 PRK13461, PRK13461, F0F1 ATP synthase subunit B; Provisional. Length = 159 Score = 26.6 bits (59), Expect = 6.7 Identities = 22/83 (26%), Positives = 38/83 (45%), Gaps = 17/83 (20%) Query: 134 ASLEERKEILYNYPTMGSQQYE----------KAFLDRLQSSLQQDREDLETKLHNQG-- 181 + EE K+I+ Y + YE ++R + Q+++E E ++ NQ Sbjct: 68 NAKEEGKKIVEEYKSKAENVYEEIVKEAHEEADLIIERAKLEAQREKEKAEYEIKNQAVD 127 Query: 182 ---LVSGSVAWNRAIDE-TNRKL 200 L+S S A +IDE +R+L Sbjct: 128 LAVLLS-SKALEESIDESEHRRL 149 >gnl|CDD|150824 pfam10209, DUF2340, Uncharacterized conserved protein (DUF2340). This is a family of small proteins of approximately 150 amino acids of unknown function. Length = 122 Score = 26.1 bits (58), Expect = 8.0 Identities = 9/36 (25%), Positives = 14/36 (38%), Gaps = 2/36 (5%) Query: 87 NINNLLLS--DLLTQRIQDLLPHHHTHVNTTKDFPP 120 N+ N++ DL +DLL + T P Sbjct: 13 NVKNVVFHDIDLKDTTAKDLLEDVKADIQTRGSLRP 48 >gnl|CDD|184853 PRK14851, PRK14851, hypothetical protein; Provisional. Length = 679 Score = 26.0 bits (57), Expect = 9.0 Identities = 12/40 (30%), Positives = 18/40 (45%), Gaps = 3/40 (7%) Query: 189 WNRAIDETNRKLHDVRLAAMLKASDEQERLDNIQEKHAYF 228 W R TNRK + R +D + R+ +I H +F Sbjct: 432 WKR---CTNRKPYSKRPLPEWVLNDLKTRIRSIPGAHLHF 468 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.314 0.130 0.369 Gapped Lambda K H 0.267 0.0659 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 3,851,590 Number of extensions: 238835 Number of successful extensions: 400 Number of sequences better than 10.0: 1 Number of HSP's gapped: 400 Number of HSP's successfully gapped: 21 Length of query: 238 Length of database: 5,994,473 Length adjustment: 91 Effective length of query: 147 Effective length of database: 4,028,145 Effective search space: 592137315 Effective search space used: 592137315 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 56 (25.5 bits)