RPS-BLAST 2.2.22 [Sep-27-2009]

Database: mmdb70 
           33,805 sequences; 4,956,049 total letters

Searching..................................................done

Query= 537021.9.peg.1064_1
         (238 letters)



>2pff_A Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl-carrier-;
           fatty acid synthase, acyl-carrier-protein, beta-ketoacyl
           reductase, beta-ketoacyl synthase, dehydratase; 4.00A
           {Saccharomyces cerevisiae} (A:1221-1330,A:1541-1688)
          Length = 258

 Score = 26.8 bits (59), Expect = 2.4
 Identities = 16/93 (17%), Positives = 32/93 (34%), Gaps = 31/93 (33%)

Query: 149 MGSQQYEKAFLD------RLQSSLQQDREDLETKLHNQGLVSGSVAWNRAIDETNRKLHD 202
             S +Y    L+      +L +   Q ++ +E +L              A+         
Sbjct: 14  HSSVKYASPNLNMKYRKRQLVTREAQIKDWVENEL-------------EALKLE------ 54

Query: 203 VRLAAMLKASDEQERLDNIQEKHAYFHNLAQAQ 235
              A  + + D+ E    + E+    HN A++Q
Sbjct: 55  ---AEEIPSEDQNE---FLLERTREIHNEAESQ 81


  Database: mmdb70
    Posted date:  Jun 20, 2010  3:12 AM
  Number of letters in database: 4,956,049
  Number of sequences in database:  33,805
  
Lambda     K      H
   0.314    0.130    0.369 

Gapped
Lambda     K      H
   0.267   0.0606    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 33805
Number of Hits to DB: 1,719,118
Number of extensions: 75185
Number of successful extensions: 162
Number of sequences better than 10.0: 1
Number of HSP's gapped: 162
Number of HSP's successfully gapped: 13
Length of query: 238
Length of database: 4,956,049
Length adjustment: 86
Effective length of query: 152
Effective length of database: 2,048,819
Effective search space: 311420488
Effective search space used: 311420488
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 53 (24.5 bits)