RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= 537021.9.peg.1073_1 (162 letters) >gnl|CDD|145657 pfam02621, DUF178, Putative periplasminc binding protein (DUF178). This family of proteins belong to the periplasmic binding protein clan. Length = 248 Score = 28.3 bits (64), Expect = 1.0 Identities = 12/32 (37%), Positives = 16/32 (50%), Gaps = 3/32 (9%) Query: 124 IAKNGDANKGVLIGEGALKVRNEKAVGVVADL 155 + + DA G+LIG+ AL E V DL Sbjct: 128 VLEGEDA--GLLIGDEALTYAREGLP-KVYDL 156 >gnl|CDD|48565 cd03016, PRX_1cys, Peroxiredoxin (PRX) family, 1-cys PRX subfamily; composed of PRXs containing only one conserved cysteine, which serves as the peroxidatic cysteine. They are homodimeric thiol-specific antioxidant (TSA) proteins that confer a protective role in cells by reducing and detoxifying hydrogen peroxide, peroxynitrite, and organic hydroperoxides. As with all other PRXs, a cysteine sulfenic acid intermediate is formed upon reaction of 1-cys PRX with its substrates. Having no resolving cysteine, the oxidized enzyme is resolved by an external small-molecule or protein reductant such as thioredoxin or glutaredoxin. Similar to typical 2-cys PRX, 1-cys PRX forms a functional dimeric unit with a B-type interface, as well as a decameric structure which is stabilized in the reduced form of the enzyme. Other oligomeric forms, tetramers and hexamers, have also been reported. Mammalian 1-cys PRX is localized cellularly in the cytosol and is expressed at high levels in brain, eye, testes and lung. The seed-specific plant 1-cys PRXs protect tissues from reactive oxygen species during desiccation and are also called rehydrins.. Length = 203 Score = 26.6 bits (59), Expect = 3.3 Identities = 9/24 (37%), Positives = 14/24 (58%), Gaps = 3/24 (12%) Query: 85 MVHPNRVMASNAETARNAFLIDPN 108 M+ P+ A + T R F+IDP+ Sbjct: 106 MIDPD---AGSTLTVRAVFIIDPD 126 >gnl|CDD|176652 cd06140, DNA_polA_I_Bacillus_like_exo, inactive DEDDy 3'-5' exonuclease domain of Bacillus stearothermophilus DNA polymerase I and similar family-A DNA polymerases. Bacillus stearothermophilus-like Polymerase I (Pol I), a subgroup of the family-A DNA polymerases, contains an inactive DnaQ-like 3'-5' exonuclease domain in the same polypeptide chain as the polymerase region. The exonuclease-like domain of these proteins possess the same fold as the Klenow fragment (KF) of Escherichia coli Pol I, but does not contain the four critical metal-binding residues necessary for activity. The function of this domain is unknown. It might act as a spacer between the polymerase and the 5'-3' exonuclease domains. Some members of this subgroup, such as those from Bacillus sphaericus and Thermus aquaticus, are thermostable DNA polymerases. Length = 178 Score = 26.1 bits (58), Expect = 4.2 Identities = 18/61 (29%), Positives = 25/61 (40%), Gaps = 7/61 (11%) Query: 98 TARNAFLIDPNM--LEFLWLRTIHEDKNIAKNG-DANKGVLIGEGALKVRNEKAVGVVAD 154 A+ I + L+ L+ ED+ I K G DA K + ALK + GV D Sbjct: 29 NGGGAYYIPLELALLDLAALKEWLEDEKIPKVGHDA-KRAYV---ALKRHGIELAGVAFD 84 Query: 155 L 155 Sbjct: 85 T 85 >gnl|CDD|73148 cd02252, nylC_like, nylC-like family; composed of proteins with similarity to Flavobacterium endo-type 6-aminohexanoate-oligomer hydrolase (EIII), the product of the nylon oligomer degradation gene, nylC. EIII is an amide hydrolase that catalyzes the degradation of highly-polymerized 6-aminohexanoate oligomers. Together with other nylon degradation enzymes, such as 6-aminohexanoate cyclic dimer hydrolase (EI) and 6-aminohexanoate dimer hydrolase (EII), EIII plays a role in the detoxification and biological removal of the synthetic by-products of nylon manufacture. EIII shows sequence similarity to L-aminopeptidase D-amidase/D-esterase (DmpA), an aminopeptidase that releases N-terminal D and L amino acids from peptide substrates. Like DmpA, EIII undergoes autocatalytic cleavage in front of a nucleophile to form a heterodimer. DmpA shows similarity in catalytic mechanism to N-terminal nucleophile (Ntn) hydrolases, which are enzymes that catalyze the cleavage of amide bonds through the nucleophilic attack of the side chain of an N-terminal serine, threonine, or cysteine.. Length = 260 Score = 26.3 bits (58), Expect = 4.4 Identities = 9/33 (27%), Positives = 13/33 (39%), Gaps = 2/33 (6%) Query: 70 IVATADIYDRPFGKVMVHPNRVMASNAETARNA 102 IV A ++D G P+ + A A A Sbjct: 97 IVPAAVLFDLGGGDKRWRPDAALGYAA--AEAA 127 >gnl|CDD|36751 KOG1538, KOG1538, KOG1538, Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only]. Length = 1081 Score = 25.8 bits (56), Expect = 5.8 Identities = 11/42 (26%), Positives = 21/42 (50%), Gaps = 3/42 (7%) Query: 97 ETARNAFLIDPNMLEFLWLRTIHEDKNIAKNGDANKGVLIGE 138 ETAR A++ + + +L I E + K G+ +L+ + Sbjct: 602 ETARKAYI---RVRDLRYLELISELEERKKRGETPNDLLLAD 640 >gnl|CDD|30426 COG0077, PheA, Prephenate dehydratase [Amino acid transport and metabolism]. Length = 279 Score = 25.2 bits (55), Expect = 10.0 Identities = 17/60 (28%), Positives = 27/60 (45%), Gaps = 7/60 (11%) Query: 97 ETARNAFLIDPNMLEFLWLRTIHEDKNIAKNGDANKGVLIGEGALKVRNEKAVGVVADLF 156 + AR F + E L TI + +NG+A+ GV+ E ++ E +V DL Sbjct: 17 QAARKLF---GSGAELLPCSTIEDVFKAVENGEADYGVVPIENSI----EGSVNETLDLL 69 >gnl|CDD|112220 pfam03395, Pox_P4A, Poxvirus P4A protein. Length = 889 Score = 25.2 bits (55), Expect = 10.0 Identities = 15/68 (22%), Positives = 28/68 (41%), Gaps = 3/68 (4%) Query: 9 TQRTFSKQILDEVMQEGYQNGDNFRHIIVSPYVKSEFVRFMSDSNVASFRYATSGKSHNN 68 +R F+ +I D+V EG + F I S Y + + + SG+S + Sbjct: 783 LERIFNARISDDVKAEGLEKYKAFSDISSSLYND---LIAIETIKALLYIIKRSGRSIDG 839 Query: 69 TIVATADI 76 T + ++ Sbjct: 840 TEIGPDEL 847 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.317 0.132 0.374 Gapped Lambda K H 0.267 0.0625 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 1,826,084 Number of extensions: 87573 Number of successful extensions: 179 Number of sequences better than 10.0: 1 Number of HSP's gapped: 179 Number of HSP's successfully gapped: 11 Length of query: 162 Length of database: 6,263,737 Length adjustment: 86 Effective length of query: 76 Effective length of database: 4,405,363 Effective search space: 334807588 Effective search space used: 334807588 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 53 (24.4 bits)