RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= 537021.9.peg.1073_1 (162 letters) >gnl|CDD|130862 TIGR01803, CM-like, chorismate mutase related enzymes. This subfamily includes two enzymes which are variants on the mechanism of chorismate mutase and are likely to have evolved from an ancestral chorismate mutase enzyme. 4-amino-4-deoxy-chorismate mutase produces amino-deoxy-prephenate which is subsequently converted to para-dimethylamino-phenylalanine, a component of the natural product pristinamycin. Isochorismate-pyruvate lyase presumably catalyzes the same type of 2+2+2 cyclo-rearrangement as chorismate mutase, but acting on isochorismate, this results in two broken bonds instead of one broken and one made. The product of this reaction is salicylate (2-hydroxy-benzoate) which is also incorporated into various natural products. Length = 82 Score = 32.9 bits (75), Expect = 0.041 Identities = 16/53 (30%), Positives = 22/53 (41%), Gaps = 2/53 (3%) Query: 70 IVATADIYDRPFGKVMVHPNRVMASNAETARNA--FLIDPNMLEFLWLRTIHE 120 V A + R + P RV A AR A +DP +E L+ + IH Sbjct: 25 YVKRASEFKRSHEAAIPAPERVAAVLPNAARWAEENGLDPPFVEGLFAQIIHW 77 >gnl|CDD|130300 TIGR01233, lacG, 6-phospho-beta-galactosidase. This enzyme is part of the tagatose-6-phosphate pathway of galactose-6-phosphate degradation. Length = 467 Score = 27.0 bits (59), Expect = 2.5 Identities = 12/72 (16%), Positives = 22/72 (30%), Gaps = 1/72 (1%) Query: 62 SGKSHNNTIVATADIYDRPFGKVMVHPNRVMASNAETARNAFLIDPNMLEFLWLRTIHED 121 G + T+ I G++ + A + + N W++ + Sbjct: 251 LGHYSDKTMEGVNHILAENGGELDLRDEDFQALD-AAKDLNDFLGINYYMSDWMQAFDGE 309 Query: 122 KNIAKNGDANKG 133 I NG KG Sbjct: 310 TEIIHNGKGEKG 321 >gnl|CDD|149602 pfam08604, Nup153, Nucleoporin Nup153-like. This family contains both the nucleoporin Nup153 from human and Nup153 from fission yeast. These have been demonstrated to be functionally equivalent. Length = 519 Score = 26.6 bits (58), Expect = 3.1 Identities = 13/50 (26%), Positives = 24/50 (48%), Gaps = 6/50 (12%) Query: 53 NVASFRYATSGKSHNNTIVATADIYDRPFGKVMVHPNRVMASNAETARNA 102 N+++F S S N++I+ + + D PF P + A AR++ Sbjct: 124 NLSAFG-TLSPSSGNDSILNLSQLGDSPFY-----PGKTTYGGAAAARSS 167 >gnl|CDD|180219 PRK05716, PRK05716, methionine aminopeptidase; Validated. Length = 252 Score = 25.9 bits (58), Expect = 4.5 Identities = 8/24 (33%), Positives = 11/24 (45%) Query: 116 RTIHEDKNIAKNGDANKGVLIGEG 139 R HE+ I G G ++ EG Sbjct: 173 RKFHEEPQIPHYGAPGDGPVLKEG 196 >gnl|CDD|183884 PRK13189, PRK13189, peroxiredoxin; Provisional. Length = 222 Score = 26.1 bits (58), Expect = 4.7 Identities = 9/24 (37%), Positives = 13/24 (54%), Gaps = 4/24 (16%) Query: 85 MVHPNRVMASNAETARNAFLIDPN 108 M+ P + +N T R F+IDP Sbjct: 116 MISPGK--GTN--TVRAVFIIDPK 135 >gnl|CDD|180923 PRK07309, PRK07309, aromatic amino acid aminotransferase; Validated. Length = 391 Score = 25.8 bits (57), Expect = 5.1 Identities = 13/40 (32%), Positives = 19/40 (47%), Gaps = 10/40 (25%) Query: 97 ETARNAFLIDPNMLEFLWLRTIHEDKNIAKNGDANKGVLI 136 +T N F++ P MLE K I + GD K V++ Sbjct: 143 DTTENDFVLTPEMLE----------KAILEQGDKLKAVIL 172 >gnl|CDD|178137 PLN02522, PLN02522, ATP citrate (pro-S)-lyase. Length = 608 Score = 25.6 bits (56), Expect = 6.3 Identities = 9/17 (52%), Positives = 14/17 (82%) Query: 13 FSKQILDEVMQEGYQNG 29 F+KQ +DE+++ GY NG Sbjct: 556 FTKQEIDEIVEIGYLNG 572 >gnl|CDD|172631 PRK14142, PRK14142, heat shock protein GrpE; Provisional. Length = 223 Score = 25.3 bits (55), Expect = 7.3 Identities = 11/25 (44%), Positives = 17/25 (68%), Gaps = 1/25 (4%) Query: 14 SKQILDEVMQEGYQNGDN-FRHIIV 37 SK ++ VM++GYQ G+ RH +V Sbjct: 154 SKPVIGTVMRQGYQLGEQVLRHALV 178 >gnl|CDD|183006 PRK11165, PRK11165, diaminopimelate decarboxylase; Provisional. Length = 420 Score = 25.3 bits (56), Expect = 7.9 Identities = 7/19 (36%), Positives = 10/19 (52%) Query: 62 SGKSHNNTIVATADIYDRP 80 + + IV TAD+ DR Sbjct: 89 KPGTEPDEIVFTADVIDRA 107 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.317 0.132 0.374 Gapped Lambda K H 0.267 0.0600 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 2,538,092 Number of extensions: 146976 Number of successful extensions: 266 Number of sequences better than 10.0: 1 Number of HSP's gapped: 264 Number of HSP's successfully gapped: 17 Length of query: 162 Length of database: 5,994,473 Length adjustment: 86 Effective length of query: 76 Effective length of database: 4,136,185 Effective search space: 314350060 Effective search space used: 314350060 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 53 (24.5 bits)