RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= 537021.9.peg.1074_1 (169 letters) >gnl|CDD|183986 PRK13342, PRK13342, recombination factor protein RarA; Reviewed. Length = 413 Score = 28.5 bits (65), Expect = 0.99 Identities = 8/31 (25%), Positives = 15/31 (48%), Gaps = 2/31 (6%) Query: 18 ESLSDVV--SRITPEDTPIYSMIKKGTTHSI 46 ++L +VV + P+ MI+ G S+ Sbjct: 9 KTLDEVVGQEHLLGPGKPLRRMIEAGRLSSM 39 >gnl|CDD|178364 PLN02764, PLN02764, glycosyltransferase family protein. Length = 453 Score = 28.1 bits (62), Expect = 1.1 Identities = 16/44 (36%), Positives = 26/44 (59%), Gaps = 6/44 (13%) Query: 16 NKESLSDVVSRITPEDTPIYSMIKKGTTHSIHPEWVVDDLASPG 59 +KESL D ++ + D+ I +++KK H +W + LASPG Sbjct: 393 SKESLRDAINSVMKRDSEIGNLVKKN-----HTKW-RETLASPG 430 >gnl|CDD|130625 TIGR01562, FdhE, formate dehydrogenase accessory protein FdhE. The only sequence scoring between trusted and noise is that from Aquifex aeolicus, which shows certain structural differences from the proteobacterial forms in the alignment. However it is notable that A. aeolicus also has a sequence scoring above trusted to the alpha subunit of formate dehydrogenase (TIGR01553). Length = 305 Score = 27.6 bits (61), Expect = 1.7 Identities = 10/29 (34%), Positives = 16/29 (55%) Query: 47 HPEWVVDDLASPGPNAQLEGDEYSFKTIN 75 H + V DDLAS + ++ D Y ++ N Sbjct: 272 HADAVADDLASLALDMRMAEDGYLRRSPN 300 >gnl|CDD|178689 PLN03144, PLN03144, Carbon catabolite repressor protein 4 homolog; Provisional. Length = 606 Score = 27.0 bits (60), Expect = 2.6 Identities = 12/39 (30%), Positives = 20/39 (51%), Gaps = 4/39 (10%) Query: 75 NTPERMGNYTQIMRKSWILSGTQEA----VDDVGYILKY 109 P + TQ+ ++WI G + DDVG++LK+ Sbjct: 158 LYPSGIEQKTQVGGETWIEVGRSKTYTPTADDVGHVLKF 196 >gnl|CDD|182635 PRK10671, copA, copper exporting ATPase; Provisional. Length = 834 Score = 25.9 bits (57), Expect = 4.9 Identities = 15/39 (38%), Positives = 21/39 (53%) Query: 112 QKLKKALEIRKDVEFALVSSQGSEKTSPRKMAALSSWIK 150 +++K++LE R DVE A VS + T AL IK Sbjct: 19 KRVKESLEQRPDVEQADVSITEAHVTGTASAEALIETIK 57 >gnl|CDD|130022 TIGR00947, 2A73, probable bicarbonate transporter, IctB family. This family of proteins is suggested to transport inorganic carbon (HCO3-), based on the phenotype of a mutant of IctB in Synechococcus sp. strain PCC 7942. Bicarbonate uptake is used by many photosynthetic organisms including cyanobacteria. These organisms are able to concentrate CO2/HCO3- against a greater than ten-fold concentration gradient. Cyanobacteria may have several such carriers operating with different efficiencies. Note that homology to various O-antigen ligases, with possible implications for mutant cell envelope structure, might allow alternatives to the interpretation of IctB as a bicarbonate transport protein. Length = 425 Score = 25.8 bits (57), Expect = 5.6 Identities = 6/13 (46%), Positives = 7/13 (53%) Query: 138 SPRKMAALSSWIK 150 SP AAL +K Sbjct: 86 SPVPAAALKGLLK 98 >gnl|CDD|139538 PRK13390, PRK13390, acyl-CoA synthetase; Provisional. Length = 501 Score = 25.7 bits (56), Expect = 5.8 Identities = 12/43 (27%), Positives = 18/43 (41%) Query: 64 LEGDEYSFKTINTPERMGNYTQIMRKSWILSGTQEAVDDVGYI 106 E D F+ +N PE+ W G +VD+ GY+ Sbjct: 353 FERDRLPFRYLNDPEKTAAAQHPAHPFWTTVGDLGSVDEDGYL 395 >gnl|CDD|180729 PRK06850, PRK06850, hypothetical protein; Provisional. Length = 507 Score = 25.7 bits (57), Expect = 5.9 Identities = 11/20 (55%), Positives = 16/20 (80%) Query: 105 YILKYKEQKLKKALEIRKDV 124 Y LKY+E+ L+K LE ++DV Sbjct: 334 YTLKYREEWLRKLLEAQRDV 353 >gnl|CDD|185460 PTZ00123, PTZ00123, phosphoglycerate mutase like-protein; Provisional. Length = 236 Score = 25.8 bits (57), Expect = 6.6 Identities = 13/35 (37%), Positives = 15/35 (42%), Gaps = 3/35 (8%) Query: 9 ITSSSTTNKESLSDVVSRITP--EDTPIYSMIKKG 41 I + N E L D V R+ P ED I I G Sbjct: 128 IPKDALPNTECLKDTVERVLPYWEDH-IAPDILAG 161 >gnl|CDD|184273 PRK13721, PRK13721, conjugal transfer ATP-binding protein TraC; Provisional. Length = 844 Score = 25.5 bits (56), Expect = 6.7 Identities = 12/47 (25%), Positives = 24/47 (51%), Gaps = 8/47 (17%) Query: 109 YKEQKLKKALEIRKDV-EFALVSSQGSEKTSPRKMAALSSWIKKNAS 154 + +QK K+ L I + V + A K +MA+L +W++++ Sbjct: 801 FVQQKRKEGLSIHEAVWQLA-------WKKFGPEMASLEAWLEEHEK 840 >gnl|CDD|116380 pfam07766, LETM1, LETM1-like protein. Members of this family are inner mitochondrial membrane proteins which play a role in potassium and hydrogen ion exchange. Deletion of LETM1 is thought to be involved in the development of Wolf-Hirschhorn syndrome in humans. Length = 268 Score = 25.3 bits (56), Expect = 8.3 Identities = 19/65 (29%), Positives = 33/65 (50%), Gaps = 7/65 (10%) Query: 110 KEQKLKKALEIRKDVEFALVSSQGSEKTSPRKMAALSSWIKKNAS-----RGTGGVLEDM 164 +E+KLKK L++RK+V L + ++ + ++S KK AS R G + Sbjct: 97 REEKLKKLLKVRKEVAKFLQETL--KEMALHNKNSISQAEKKFASFFQKVRSGGEPSNEE 154 Query: 165 ILSLA 169 IL ++ Sbjct: 155 ILDVS 159 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.310 0.126 0.351 Gapped Lambda K H 0.267 0.0697 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 2,666,152 Number of extensions: 156082 Number of successful extensions: 230 Number of sequences better than 10.0: 1 Number of HSP's gapped: 230 Number of HSP's successfully gapped: 19 Length of query: 169 Length of database: 5,994,473 Length adjustment: 87 Effective length of query: 82 Effective length of database: 4,114,577 Effective search space: 337395314 Effective search space used: 337395314 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.8 bits) S2: 53 (24.3 bits)