RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= 537021.9.peg.1078_1 (62 letters) >gnl|CDD|146059 pfam03237, Terminase_6, Terminase-like family. This family represents a group of terminase proteins. Length = 380 Score = 30.1 bits (68), Expect = 0.14 Identities = 12/40 (30%), Positives = 14/40 (35%), Gaps = 3/40 (7%) Query: 5 LECQEWLDEFHQYHR---CEGRVIKEKDDLICASRYALMM 41 C +E YH E + DD A RYAL Sbjct: 340 AWCPASFEELEAYHTDGGNERSDVDGHDDAADALRYALNS 379 >gnl|CDD|72857 cd04717, BAH_polybromo, BAH, or Bromo Adjacent Homology domain, as present in polybromo and yeast RSC1/2. The human polybromo protein (BAF180) is a component of the SWI/SNF chromatin-remodeling complex PBAF. It is thought that polybromo participates in transcriptional regulation. Saccharomyces cerevisiae RSC1 and RSC2 are part of the 15-subunit nucleosome remodeling RSC complex. BAH domains are found in a variety of proteins playing roles in transcriptional silencing and the remodeling of chromatin. It is assumed that in most or all of these instances the BAH domain mediates protein-protein interactions.. Length = 121 Score = 25.9 bits (57), Expect = 2.3 Identities = 10/36 (27%), Positives = 15/36 (41%) Query: 10 WLDEFHQYHRCEGRVIKEKDDLICASRYALMMKIFS 45 + + Y + I E+D +C SRY K F Sbjct: 82 AVMDVKDYIKGRPTEISEEDVYVCESRYNESAKSFK 117 >gnl|CDD|33366 COG3564, COG3564, Uncharacterized protein conserved in bacteria [Function unknown]. Length = 116 Score = 25.3 bits (55), Expect = 3.5 Identities = 15/51 (29%), Positives = 21/51 (41%), Gaps = 7/51 (13%) Query: 14 FHQYHRC---EGRVIKEKDDLICASRYALMMKI----FSISKPGYSSWKYT 57 FHQ C + + D I L+ +I IS P Y +WK+T Sbjct: 29 FHQSGGCCDGSSPMCYPRADFIVGDNDVLLGEIDGVPVYISGPQYEAWKHT 79 >gnl|CDD|30368 COG0018, ArgS, Arginyl-tRNA synthetase [Translation, ribosomal structure and biogenesis]. Length = 577 Score = 24.1 bits (52), Expect = 7.8 Identities = 8/29 (27%), Positives = 17/29 (58%), Gaps = 3/29 (10%) Query: 14 FHQ-YHRCEGRVIKEKDDLICASRYALMM 41 F+ Y+ C V+ +++ + A+R AL+ Sbjct: 530 FNSFYNAC--PVLGAENEELRAARLALVK 556 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.324 0.138 0.447 Gapped Lambda K H 0.267 0.0680 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 833,010 Number of extensions: 31090 Number of successful extensions: 76 Number of sequences better than 10.0: 1 Number of HSP's gapped: 76 Number of HSP's successfully gapped: 11 Length of query: 62 Length of database: 6,263,737 Length adjustment: 34 Effective length of query: 28 Effective length of database: 5,529,031 Effective search space: 154812868 Effective search space used: 154812868 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 51 (23.5 bits)