BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 537021.9.peg.1078_1 (62 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >537021.9.peg.1078_1 Length = 62 Score = 130 bits (328), Expect = 3e-33, Method: Compositional matrix adjust. Identities = 62/62 (100%), Positives = 62/62 (100%) Query: 1 LESILECQEWLDEFHQYHRCEGRVIKEKDDLICASRYALMMKIFSISKPGYSSWKYTPRK 60 LESILECQEWLDEFHQYHRCEGRVIKEKDDLICASRYALMMKIFSISKPGYSSWKYTPRK Sbjct: 1 LESILECQEWLDEFHQYHRCEGRVIKEKDDLICASRYALMMKIFSISKPGYSSWKYTPRK 60 Query: 61 VI 62 VI Sbjct: 61 VI 62 >gi|254780947|ref|YP_003065360.1| transcription-repair coupling factor [Candidatus Liberibacter asiaticus str. psy62] Length = 1187 Score = 22.7 bits (47), Expect = 1.1, Method: Composition-based stats. Identities = 15/43 (34%), Positives = 21/43 (48%), Gaps = 2/43 (4%) Query: 13 EFHQYHRCEGRVIKEKDDLICASRYALMMKIFSISKPGYSSWK 55 E H + V E DLI SRY+ + ++ K G S+WK Sbjct: 536 ELHYADNAKLFVPVENIDLI--SRYSTEITTVTLDKLGGSAWK 576 >gi|254780234|ref|YP_003064647.1| argininosuccinate synthase [Candidatus Liberibacter asiaticus str. psy62] Length = 404 Score = 20.4 bits (41), Expect = 6.5, Method: Composition-based stats. Identities = 6/12 (50%), Positives = 9/12 (75%) Query: 11 LDEFHQYHRCEG 22 L++ +QY RC G Sbjct: 246 LEQLNQYGRCNG 257 >537021.9.peg.410_1 Length = 952 Score = 20.0 bits (40), Expect = 7.2, Method: Compositional matrix adjust. Identities = 11/39 (28%), Positives = 22/39 (56%) Query: 24 VIKEKDDLICASRYALMMKIFSISKPGYSSWKYTPRKVI 62 ++K+ L AS+ + + FS+ + + K+TP+K I Sbjct: 46 ILKKAQTLQQASQTQCIEERFSLLSSFFLTQKFTPQKNI 84 >gi|254781066|ref|YP_003065479.1| putative lysyl-tRNA synthetase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 355 Score = 20.0 bits (40), Expect = 7.8, Method: Compositional matrix adjust. Identities = 9/22 (40%), Positives = 12/22 (54%) Query: 7 CQEWLDEFHQYHRCEGRVIKEK 28 C E LD Q HR E + ++K Sbjct: 275 CDELLDPIEQRHRFEKEMQEKK 296 >gi|254780866|ref|YP_003065279.1| NADH dehydrogenase subunit M [Candidatus Liberibacter asiaticus str. psy62] Length = 499 Score = 20.0 bits (40), Expect = 8.2, Method: Composition-based stats. Identities = 6/15 (40%), Positives = 9/15 (60%) Query: 4 ILECQEWLDEFHQYH 18 ++E W+D F YH Sbjct: 64 MIEYYHWIDYFCSYH 78 >gi|254780984|ref|YP_003065397.1| hypothetical protein CLIBASIA_04425 [Candidatus Liberibacter asiaticus str. psy62] Length = 125 Score = 19.6 bits (39), Expect = 8.7, Method: Compositional matrix adjust. Identities = 8/17 (47%), Positives = 11/17 (64%) Query: 37 YALMMKIFSISKPGYSS 53 Y +I + +KPGYSS Sbjct: 30 YGSEERIATCAKPGYSS 46 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.324 0.138 0.447 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 43,287 Number of Sequences: 1233 Number of extensions: 1200 Number of successful extensions: 8 Number of sequences better than 100.0: 8 Number of HSP's better than 100.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of query: 62 length of database: 328,796 effective HSP length: 34 effective length of query: 28 effective length of database: 286,874 effective search space: 8032472 effective search space used: 8032472 T: 11 A: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 39 (21.1 bits) S2: 31 (16.5 bits)