RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= 537021.9.peg.1079_1 (251 letters) >gnl|CDD|150434 pfam09763, Sec3, Exocyst complex component Sec3. This entry is the conserved middle and C-terminus of the Sec3 protein. Sec3 binds to the C-terminal cytoplasmic domain of GLYT1 (glycine transporter protein 1). Sec3 is the exocyst component that is closest to the plasma membrane docking site and it serves as a spatial landmark in the plasma membrane for incoming secretory vesicles. Sec3 is recruited to the sites of polarized membrane growth through its interaction with Rho1p, a small GTP-binding protein. Length = 690 Score = 28.1 bits (63), Expect = 2.3 Identities = 10/43 (23%), Positives = 18/43 (41%) Query: 56 PIIEHYLSASSSDRQVIRMTINETPHYNEQERKRIIDSYPLHE 98 +IE + V I+ Y++Q K+++ SY E Sbjct: 593 KLIEFVEGVEALLATVPAEEISRQAAYSKQALKKVLKSYTAKE 635 >gnl|CDD|181700 PRK09209, PRK09209, ribonucleotide-diphosphate reductase subunit alpha; Validated. Length = 761 Score = 27.8 bits (62), Expect = 2.5 Identities = 16/52 (30%), Positives = 23/52 (44%), Gaps = 6/52 (11%) Query: 122 IVINSLDIP------EHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNY 167 I +N L +P + + IG FGWHH A + W + V Y + Y Sbjct: 522 IDLNQLPVPQATITNQKYRAIGLGTFGWHHLLALKGIAWESEEAVQYADELY 573 >gnl|CDD|179871 PRK04663, murD, UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional. Length = 438 Score = 27.8 bits (62), Expect = 3.0 Identities = 12/27 (44%), Positives = 15/27 (55%), Gaps = 1/27 (3%) Query: 205 EQLSAQYRRQGMKML-PECATFDDGSN 230 E +S Q + M ML P CA+FD N Sbjct: 396 ESISPQLKSGDMVMLSPACASFDQFKN 422 >gnl|CDD|179797 PRK04235, PRK04235, hypothetical protein; Provisional. Length = 196 Score = 26.8 bits (60), Expect = 6.0 Identities = 21/76 (27%), Positives = 29/76 (38%), Gaps = 22/76 (28%) Query: 111 SGRIFPIVEEDIVINSLDIPEHWVQIGGMDFG-WHHPFAAGHLVWNRDSDVIYVVKNYRC 169 SGRI I+E ++ P + G WHHP +V+ +K + Sbjct: 48 SGRI-GIIEAEM-------PSKGDKKNSRWLGKWHHPVTP--------EEVLEALKKKQV 91 Query: 170 RE-----QTPIFHVAA 180 Q PI HVAA Sbjct: 92 GRLWLIVQGPILHVAA 107 >gnl|CDD|150740 pfam10100, DUF2338, Uncharacterized protein conserved in bacteria (DUF2338). Members of this family of hypothetical bacterial proteins have no known function. Length = 429 Score = 26.6 bits (59), Expect = 6.1 Identities = 17/74 (22%), Positives = 34/74 (45%), Gaps = 10/74 (13%) Query: 2 KAYEQGRDKWQSNTVHYVWFDEEPPEDVYFEGLTRI-NATQGLV--TLTLTPLKGRSPII 58 K Y W + + V D Y++ L +I T V + ++P G + ++ Sbjct: 75 KDYATIVGDWDT-LILAV------TADAYYDVLQQIPWETLKRVKCVILISPTFGSNLLV 127 Query: 59 EHYLSASSSDRQVI 72 +++L+A + D +VI Sbjct: 128 QNFLNALNKDAEVI 141 >gnl|CDD|182572 PRK10590, PRK10590, ATP-dependent RNA helicase RhlE; Provisional. Length = 456 Score = 26.3 bits (58), Expect = 8.6 Identities = 20/54 (37%), Positives = 24/54 (44%), Gaps = 3/54 (5%) Query: 81 HYNEQERKRIIDSYPLH---EREARTKGEPILGSGRIFPIVEEDIVINSLDIPE 131 H EQ K I S +H + ART+ SG I +V DI LDI E Sbjct: 260 HLAEQLNKDGIRSAAIHGNKSQGARTRALADFKSGDIRVLVATDIAARGLDIEE 313 >gnl|CDD|184719 PRK14511, PRK14511, maltooligosyl trehalose synthase; Provisional. Length = 879 Score = 26.1 bits (58), Expect = 9.0 Identities = 12/38 (31%), Positives = 13/38 (34%), Gaps = 12/38 (31%) Query: 188 LPWAWPHDG------------LQHDKRSGEQLSAQYRR 213 LP WP DG L D E L+ Y R Sbjct: 337 LPEDWPVDGTTGYDFLNQVNGLLVDPAGEEPLTELYAR 374 >gnl|CDD|162351 TIGR01420, pilT_fam, pilus retraction protein PilT. This model represents the PilT subfamily of proteins related to GspE, a protein involved in type II secretion (also called the General Secretion Pathway). PilT is an apparent cytosolic ATPase associated with type IV pilus systems. It is not required for pilin biogenesis, but is required for twitching motility and social gliding behaviors, shown in some species, powered by pilus retraction. Members of this family may be found in some species that type IV pili but have related structures for DNA uptake and natural transformation. Length = 343 Score = 26.1 bits (58), Expect = 9.5 Identities = 6/13 (46%), Positives = 9/13 (69%) Query: 89 RIIDSYPLHEREA 101 RIID +P E++ Sbjct: 238 RIIDVFPAEEQDQ 250 >gnl|CDD|183016 PRK11176, PRK11176, lipid transporter ATP-binding/permease protein; Provisional. Length = 582 Score = 26.1 bits (58), Expect = 9.7 Identities = 8/22 (36%), Positives = 15/22 (68%) Query: 205 EQLSAQYRRQGMKMLPECATFD 226 +++S + R+QGMKM+ + D Sbjct: 231 DKVSNRMRQQGMKMVSASSISD 252 >gnl|CDD|162762 TIGR02208, lipid_A_msbB, lipid A biosynthesis (KDO)2-(lauroyl)-lipid IVA acyltransferase. This family consists of MsbB in E. coli and closely related proteins in other species. MsbB is homologous to HtrB (TIGR02207) and acts immediately after it in the biosynthesis of KDO-2 lipid A (also called Re LPS and Re endotoxin). These two enzymes act after creation of KDO-2 lipid IV-A by addition of the KDO sugars. Length = 305 Score = 25.9 bits (57), Expect = 9.9 Identities = 18/55 (32%), Positives = 24/55 (43%), Gaps = 5/55 (9%) Query: 43 LVTLTLTPLKGRSPIIEHY--LSASSSDRQVIRMTINET---PHYNEQERKRIID 92 LV L P K R PI + + + R IN + P +E ER+ IID Sbjct: 24 LVLLAFMPAKLRDPIAKVLAKFVGPIAKKPRGRARINLSACFPEKSEAERETIID 78 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.319 0.137 0.444 Gapped Lambda K H 0.267 0.0551 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 4,352,359 Number of extensions: 274480 Number of successful extensions: 499 Number of sequences better than 10.0: 1 Number of HSP's gapped: 499 Number of HSP's successfully gapped: 16 Length of query: 251 Length of database: 5,994,473 Length adjustment: 91 Effective length of query: 160 Effective length of database: 4,028,145 Effective search space: 644503200 Effective search space used: 644503200 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 56 (25.8 bits)