RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= 537021.9.peg.1080_1 (110 letters) >gnl|CDD|179913 PRK05007, PRK05007, PII uridylyl-transferase; Provisional. Length = 884 Score = 27.2 bits (61), Expect = 0.90 Identities = 12/21 (57%), Positives = 13/21 (61%), Gaps = 1/21 (4%) Query: 78 LNMTRRSNIAGAYSTVTVRHL 98 M R SNI G YST T+R L Sbjct: 375 YLMARNSNITGIYST-TLRQL 394 >gnl|CDD|185381 PRK15484, PRK15484, lipopolysaccharide 1,2-N-acetylglucosaminetransferase; Provisional. Length = 380 Score = 27.1 bits (60), Expect = 0.99 Identities = 13/41 (31%), Positives = 18/41 (43%), Gaps = 3/41 (7%) Query: 47 ELTRDGIQRLLLGEPMSPDQQGSGMIPANKVLNMTRRSNIA 87 E +GI L EPM+ D S + N+ L + IA Sbjct: 314 EFVLEGITGYHLAEPMTSDSIISDI---NRTLADPELTQIA 351 >gnl|CDD|161736 TIGR00160, MGSA, methylglyoxal synthase. Methylglyoxal synthase (MGS) generates methylglyoxal (MG), a toxic metabolite (that may also be a regulatory metabolite and) that is detoxified, prinicipally, through a pathway involving glutathione and glyoxylase I. Totemeyer, et al. (MUID:98149311) propose that, during a loss of control over carbon flux, with accumulation of phosphorylated sugars and depletion of phosphate, as might happen during a rapid shift to a richer medium, MGS aids the cell by converting some dihydroxyacetone phosphate (DHAP) to MG and phosphate. This is therefore an alternative to triosephosphate isomerase and the remainder of the glycolytic pathway for the disposal of DHAP during the stress of a sudden increase in available sugars. Length = 143 Score = 27.1 bits (60), Expect = 1.1 Identities = 14/56 (25%), Positives = 20/56 (35%), Gaps = 5/56 (8%) Query: 29 RGYRFLQPIVMVAGSVTYELTRDG----IQRLLLGEPMSPDQQGSGMIPANKVLNM 80 + L + A T L I +L G PM DQQ +I K+ + Sbjct: 23 QHKPLLSQHDLYATGTTGNLISRATGLNINAMLSG-PMGGDQQIGALIAEGKIDAV 77 >gnl|CDD|130585 TIGR01522, ATPase-IIA2_Ca, golgi membrane calcium-translocating P-type ATPase. The calcium P-type ATPases have been characterized as Type IIA based on a phylogenetic analysis which distinguishes this group from the Type IIB PMCA calcium pump modelled by TIGR01517. A separate analysis divides Type IIA into sub-types, SERCA and PMR1 the former of which is modelled by TIGR01116. Length = 884 Score = 26.3 bits (58), Expect = 1.8 Identities = 16/47 (34%), Positives = 23/47 (48%), Gaps = 3/47 (6%) Query: 57 LLGEPMSPDQQGSGMIPANKVLNMTRRSNIAGAYSTVTVRHLSGRDI 103 L GE +P + + IPA ++ RSNI A+ VR G+ I Sbjct: 168 LTGE-TTPVSKVTAPIPAATNGDLAERSNI--AFMGTLVRCGHGKGI 211 >gnl|CDD|183589 PRK12553, PRK12553, ATP-dependent Clp protease proteolytic subunit; Reviewed. Length = 207 Score = 25.3 bits (56), Expect = 3.4 Identities = 10/34 (29%), Positives = 18/34 (52%) Query: 33 FLQPIVMVAGSVTYELTRDGIQRLLLGEPMSPDQ 66 F + I+ + G V D + +LL+ E + PD+ Sbjct: 33 FEERIIFLGGQVDDASANDVMAQLLVLESIDPDR 66 >gnl|CDD|151033 pfam10460, Peptidase_M30, Peptidase M30. This family contains the metallopeptidase hyicolysin. Hyicolysin has a zinc ion which is liganded by two histidine and one glutamate residue. Length = 366 Score = 24.5 bits (53), Expect = 6.5 Identities = 8/22 (36%), Positives = 12/22 (54%) Query: 59 GEPMSPDQQGSGMIPANKVLNM 80 G P P+ S MIP + L++ Sbjct: 62 GPPWGPNSYSSSMIPTGQPLDI 83 >gnl|CDD|162856 TIGR02435, CobG, precorrin-3B synthase. An iron-sulfur protein. An oxygen atom from dioxygen is incorporated into the macrocycle at C-20. In the aerobic cobalamin biosythesis pathway, four enzymes are involved in the conversion of precorrin-3A to precorrin-6A. The first of the four steps is carried out by EC 1.14.13.83, precorrin-3B synthase (CobG), yielding precorrin-3B as the product. This is followed by three methylation reactions, which introduce a methyl group at C-17 (CobJ; EC 2.1.1.131), C-11 (CobM; EC 2.1.1.133) and C-1 (CobF; EC 2.1.1.152) of the macrocycle, giving rise to precorrin-4, precorrin-5 and precorrin-6A, respectively. Length = 390 Score = 24.4 bits (53), Expect = 6.7 Identities = 11/44 (25%), Positives = 14/44 (31%), Gaps = 2/44 (4%) Query: 3 GNQLGKTLAGAAEAAMHLSGCYPSWWRGYRFLQPIVMVAGSVTY 46 L A +HLSGC + I +VA Y Sbjct: 349 AEALAAYCEPTAPITVHLSGCAKGC--AHPGPAAITLVAAGAGY 390 >gnl|CDD|138914 PRK12370, PRK12370, invasion protein regulator; Provisional. Length = 553 Score = 24.4 bits (53), Expect = 7.2 Identities = 7/13 (53%), Positives = 12/13 (92%) Query: 29 RGYRFLQPIVMVA 41 +GYRF +P+V+V+ Sbjct: 101 QGYRFNRPVVVVS 113 >gnl|CDD|181347 PRK08276, PRK08276, long-chain-fatty-acid--CoA ligase; Validated. Length = 502 Score = 24.1 bits (53), Expect = 8.7 Identities = 7/23 (30%), Positives = 13/23 (56%) Query: 86 IAGAYSTVTVRHLSGRDIGFIIE 108 +G Y T HL+ +I +I++ Sbjct: 58 RSGLYYTPINWHLTAAEIAYIVD 80 >gnl|CDD|182943 PRK11069, recC, exonuclease V subunit gamma; Provisional. Length = 1122 Score = 23.7 bits (52), Expect = 10.0 Identities = 9/28 (32%), Positives = 15/28 (53%), Gaps = 3/28 (10%) Query: 52 GIQRLLLGEPMSPDQQG--SGMIPANKV 77 G+ R+LLG M G G++P ++ Sbjct: 527 GLTRMLLGYAM-ESAAGEWQGVLPYDES 553 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.320 0.135 0.407 Gapped Lambda K H 0.267 0.0645 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 1,815,908 Number of extensions: 102983 Number of successful extensions: 181 Number of sequences better than 10.0: 1 Number of HSP's gapped: 181 Number of HSP's successfully gapped: 20 Length of query: 110 Length of database: 5,994,473 Length adjustment: 76 Effective length of query: 34 Effective length of database: 4,352,265 Effective search space: 147977010 Effective search space used: 147977010 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.2 bits)