RPS-BLAST 2.2.22 [Sep-27-2009] Database: scop70_1_75 13,730 sequences; 2,407,596 total letters Searching..................................................done Query= 537021.9.peg.1080_1 (110 letters) >d1i27a_ a.4.5.30 (A:) C-terminal domain of the rap74 subunit of TFIIF {Human (Homo sapiens) [TaxId: 9606]} Length = 73 Score = 23.2 bits (50), Expect = 5.3 Identities = 8/26 (30%), Positives = 14/26 (53%) Query: 41 AGSVTYELTRDGIQRLLLGEPMSPDQ 66 GS ++T D ++R L +PM+ Sbjct: 3 LGSGDVQVTEDAVRRYLTRKPMTTKD 28 >d1mtyd_ a.25.1.2 (D:) Methane monooxygenase hydrolase alpha subunit {Methylococcus capsulatus [TaxId: 414]} Length = 512 Score = 23.3 bits (50), Expect = 5.8 Identities = 2/12 (16%), Positives = 7/12 (58%) Query: 27 WWRGYRFLQPIV 38 +W ++ P++ Sbjct: 261 FWTQQKYFTPVL 272 >d3cpta1 d.110.7.1 (A:3-118) MEK binding partner 1, MP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 116 Score = 23.1 bits (50), Expect = 6.0 Identities = 10/59 (16%), Positives = 21/59 (35%), Gaps = 8/59 (13%) Query: 49 TRDGIQRLLLGEPMSPDQQGSGMI-----PANKV---LNMTRRSNIAGAYSTVTVRHLS 99 RDG+ + + +P+ A L +++ +I Y+T V + Sbjct: 24 DRDGVPVIKVANDNAPEHALRPGFLSTFALATDQGSKLGLSKNKSIICYYNTYQVVQFN 82 >d1v6ca_ c.41.1.1 (A:) Alkaline serine protease Apa1 {Pseudoalteromonas sp. AS-11 [TaxId: 247492]} Length = 435 Score = 23.1 bits (48), Expect = 6.3 Identities = 12/52 (23%), Positives = 17/52 (32%), Gaps = 12/52 (23%) Query: 39 MVAGSVTY------ELTRDGIQRLL------LGEPMSPDQQGSGMIPANKVL 78 V+G T E + ++ L L +Q G GMI A Sbjct: 374 HVSGVATLVWSYHPECSASQVRAALNATADDLSVAGRDNQTGYGMINAVAAK 425 >d1wmda2 c.41.1.1 (A:1-318) Alkaline serine protease kp-43, N-terminal domain {Bacillus sp. KSM-KP43 [TaxId: 109322]} Length = 318 Score = 23.3 bits (48), Expect = 6.6 Identities = 7/23 (30%), Positives = 11/23 (47%) Query: 58 LGEPMSPDQQGSGMIPANKVLNM 80 +G QG G + +K LN+ Sbjct: 296 IGLGYPNGNQGWGRVTLDKSLNV 318 >d1r6va_ c.41.1.1 (A:) Fervidolysin {Fervidobacterium pennivorans [TaxId: 93466]} Length = 671 Score = 22.7 bits (47), Expect = 8.8 Identities = 12/74 (16%), Positives = 18/74 (24%), Gaps = 12/74 (16%) Query: 39 MVAGSVTY------ELTRDGIQRLL------LGEPMSPDQQGSGMIPANKVLNMTRRSNI 86 V G V I++LL G G++ + L + Sbjct: 386 HVTGVVAVLLQKFPNAKPWQIRKLLENTAFDFNGNGWDHDTGYGLVKLDAALQGPLPTQG 445 Query: 87 AGAYSTVTVRHLSG 100 V V G Sbjct: 446 GVEEFQVVVTDAKG 459 >d3cnva1 d.190.1.2 (A:98-259) Putative transcriptional regulator BB3683 {Bordetella bronchiseptica [TaxId: 518]} Length = 162 Score = 22.4 bits (47), Expect = 9.5 Identities = 6/22 (27%), Positives = 13/22 (59%) Query: 62 MSPDQQGSGMIPANKVLNMTRR 83 ++PD++G G +++L R Sbjct: 8 LAPDEEGEGGRAESRILECRRL 29 Database: scop70_1_75 Posted date: Mar 27, 2010 6:21 PM Number of letters in database: 2,407,596 Number of sequences in database: 13,730 Lambda K H 0.320 0.135 0.407 Gapped Lambda K H 0.267 0.0676 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 13730 Number of Hits to DB: 405,370 Number of extensions: 15943 Number of successful extensions: 32 Number of sequences better than 10.0: 1 Number of HSP's gapped: 32 Number of HSP's successfully gapped: 8 Length of query: 110 Length of database: 2,407,596 Length adjustment: 69 Effective length of query: 41 Effective length of database: 1,460,226 Effective search space: 59869266 Effective search space used: 59869266 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.0 bits)