Query 537021.9.peg.1086_1 Match_columns 38 No_of_seqs 1 out of 3 Neff 1.0 Searched_HMMs 39220 Date Wed May 25 08:34:31 2011 Command /home/congqian_1/programs/hhpred/hhsearch -i peg_1086.hhm -d /home/congqian_1/database/cdd/Cdd.hhm No Hit Prob E-value P-value Score SS Cols Query HMM Template HMM 1 PTZ00129 40S ribosomal protein 26.7 32 0.00082 17.7 1.3 34 3-36 6-41 (150) 2 cd05874 Ig6_NrCAM Sixth immuno 24.3 45 0.0012 17.0 1.7 23 11-33 40-63 (77) 3 TIGR01350 lipoamide_DH dihydro 21.7 38 0.00097 17.4 0.8 10 22-33 33-42 (481) 4 PRK09733 putative fimbrial pro 18.4 40 0.001 17.2 0.4 23 2-24 29-51 (181) 5 cd05897 Ig2_IL1R2_like Second 17.8 79 0.002 15.7 1.8 18 21-38 63-92 (95) 6 pfam07315 DUF1462 Protein of u 15.5 38 0.00098 17.3 -0.3 23 3-25 3-25 (93) 7 cd05854 Ig6_Contactin-2 Sixth 14.7 83 0.0021 15.6 1.2 14 22-35 56-69 (85) 8 COG3947 Response regulator con 12.9 1.1E+02 0.0028 15.0 1.5 23 16-38 117-140 (361) 9 cd05742 Ig1_VEGFR_like First i 11.7 1.6E+02 0.0041 14.1 2.0 27 6-34 44-70 (84) 10 pfam05579 Peptidase_S32 Equine 11.3 70 0.0018 16.0 0.0 11 8-18 359-369 (426) No 1 >PTZ00129 40S ribosomal protein S14; Provisional Probab=26.74 E-value=32 Score=17.72 Aligned_cols=34 Identities=18% Similarity=0.455 Sum_probs=26.9 Q ss_pred CCCCEEEEEECCCCCCCCCCCCC--CEEEEEECEEE Q ss_conf 22211331000065321222335--16566402487 Q 537021.9.peg.1 3 YKNAMVSASCSIAPESRRSESWG--GIYTCFNRTIQ 36 (38) Q Consensus 3 yknamvsascsiapesrrseswg--giytcfnrtiq 36 (38) -|.+|-....++-|.-+....|| -||.-||.||- T Consensus 6 ~k~~~~~~~~~~~~~~~~~~v~GvaHI~ASfNNTIV 41 (150) T PTZ00129 6 TKTQVPETPTTLGPQVKGEHVFGVAHVFASFNDTFI 41 (150) T ss_pred CCCCCCCCCEECCCCCCCCEEEEEEEEECCCCCEEE T ss_conf 566363154003772236537799999824587189 No 2 >cd05874 Ig6_NrCAM Sixth immunoglobulin (Ig)-like domain of NrCAM (Ng (neuronglia) CAM-related cell adhesion molecule). Ig6_NrCAM: sixth immunoglobulin (Ig)-like domain of NrCAM (Ng (neuronglia) CAM-related cell adhesion molecule). NrCAM belongs to the L1 subfamily of cell adhesion molecules (CAMs) and is comprised of an extracellular region having six Ig-like domains and five fibronectin type III domains, a transmembrane region, and an intracellular domain. NrCAM is primarily expressed in the nervous system. Probab=24.29 E-value=45 Score=16.96 Aligned_cols=23 Identities=26% Similarity=0.652 Sum_probs=15.6 Q ss_pred EECCC-CCCCCCCCCCCEEEEEEC Q ss_conf 00006-532122233516566402 Q 537021.9.peg.1 11 SCSIA-PESRRSESWGGIYTCFNR 33 (38) Q Consensus 11 scsia-pesrrseswggiytcfnr 33 (38) +-.|. +..++.++.-|+|.||-+ T Consensus 40 tl~I~~~~~~~~~~~~G~YqC~A~ 63 (77) T cd05874 40 TLVINIMNGEKAEAYEGVYQCTAR 63 (77) T ss_pred EEEEECCCCCCCCCCCEEEEEEEE T ss_conf 599963587877566889999998 No 3 >TIGR01350 lipoamide_DH dihydrolipoamide dehydrogenase; InterPro: IPR006258 These sequences represent dihydrolipoamide dehydrogenase, a flavoprotein that acts in a number of ways. It is the E3 component of dehydrogenase complexes for pyruvate, 2-oxoglutarate, 2-oxoisovalerate, and acetoin. It can also serve as the L protein of the glycine cleavage system. This family includes a few members known to have distinct functions (ferric leghemoglobin reductase and NADH:ferredoxin oxidoreductase) but that may be predicted by homology to act as dihydrolipoamide dehydrogenase as well. The motif GGXCXXXGCXP near the N-terminus contains a redox-active disulphide. ; GO: 0004148 dihydrolipoyl dehydrogenase activity, 0050660 FAD binding, 0006118 electron transport. Probab=21.65 E-value=38 Score=17.36 Aligned_cols=10 Identities=60% Similarity=1.132 Sum_probs=7.2 Q ss_pred CCCCCEEEEEEC Q ss_conf 233516566402 Q 537021.9.peg.1 22 ESWGGIYTCFNR 33 (38) Q Consensus 22 eswggiytcfnr 33 (38) +.||| ||.|| T Consensus 33 ~~lGG--tCLN~ 42 (481) T TIGR01350 33 EKLGG--TCLNV 42 (481) T ss_pred CCCCC--EEECC T ss_conf 35687--48727 No 4 >PRK09733 putative fimbrial protein; Provisional Probab=18.45 E-value=40 Score=17.22 Aligned_cols=23 Identities=30% Similarity=0.566 Sum_probs=16.9 Q ss_pred CCCCCEEEEEECCCCCCCCCCCC Q ss_conf 42221133100006532122233 Q 537021.9.peg.1 2 RYKNAMVSASCSIAPESRRSESW 24 (38) Q Consensus 2 ryknamvsascsiapesrrsesw 24 (38) .++-..+.+.|+|.|+|+..+-. T Consensus 29 ~F~G~Iv~~~C~I~~~s~~qtVd 51 (181) T PRK09733 29 KFKGEVISAPCSIKPGDEDLTVN 51 (181) T ss_pred EEEEEEEECCCEECCCCCEEEEE T ss_conf 99999990565281888769999 No 5 >cd05897 Ig2_IL1R2_like Second immunoglobulin (Ig)-like domain of interleukin-1 receptor-2 (IL1R2). Ig2_IL1R2_like: domain similar to the second immunoglobulin (Ig)-like domain of interleukin-1 receptor-2 (IL1R2). IL-1 alpha and IL-1 beta are cytokines which participate in the regulation of inflammation, immune responses, and hematopoiesis. These cytokines bind to the IL-1 receptor type 1 (IL1R1), which is activated on additional association with an accessory protein, IL1RAP. IL-1 also binds the type II (IL1R2) represented in this group. Mature IL1R2 consists of three IG-like domains, a transmembrane domain, and a short cytoplasmic domain. It lacks the large cytoplasmic domain of Mature IL1R1, and does not initiate signal transduction. A naturally occurring cytokine IL-1RA (IL-1 receptor antagonist) is widely expressed and binds to IL-1 receptors, inhibiting the binding of IL-1 alpha and IL-1 beta. Probab=17.83 E-value=79 Score=15.75 Aligned_cols=18 Identities=50% Similarity=0.717 Sum_probs=12.3 Q ss_pred CCCCCCEEEEE------------ECEEEEC Q ss_conf 22335165664------------0248719 Q 537021.9.peg.1 21 SESWGGIYTCF------------NRTIQLR 38 (38) Q Consensus 21 seswggiytcf------------nrtiqlr 38 (38) +..-+|-|||- .|+|+|+ T Consensus 63 ~~~d~G~YTC~~tyt~~Gk~YnVTR~I~L~ 92 (95) T cd05897 63 SLNDSGYYTCKLQFTHEGKKYNITRIIKLR 92 (95) T ss_pred CCCCCCEEEEEEEEEECCEEEEEEEEEEEE T ss_conf 701394658999998899998899999999 No 6 >pfam07315 DUF1462 Protein of unknown function (DUF1462). This family consists of several hypothetical bacterial proteins of around 100 residues in length. The function of this family is unknown. Probab=15.47 E-value=38 Score=17.34 Aligned_cols=23 Identities=35% Similarity=0.683 Sum_probs=19.3 Q ss_pred CCCCEEEEEECCCCCCCCCCCCC Q ss_conf 22211331000065321222335 Q 537021.9.peg.1 3 YKNAMVSASCSIAPESRRSESWG 25 (38) Q Consensus 3 yknamvsascsiapesrrseswg 25 (38) |-...+-|||--+|.|.....|- T Consensus 3 YGA~~~CASCV~~PsSkeT~EWL 25 (93) T pfam07315 3 YGAEVICASCVNAPSSKDTYEWL 25 (93) T ss_pred CCCCCCCHHHCCCCCCHHHHHHH T ss_conf 25455134413898714189999 No 7 >cd05854 Ig6_Contactin-2 Sixth Ig domain of contactin-2. Ig6_Contactin-2: Sixth Ig domain of the neural cell adhesion molecule contactin-2-like. Contactins are comprised of six Ig domains followed by four fibronectin type III (FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. Contactin-2 (TAG-1, axonin-1) facilitates cell adhesion by homophilic binding between molecules in apposed membranes. It may play a part in the neuronal processes of neurite outgrowth, axon guidance and fasciculation, and neuronal migration. The first four Ig domains form the intermolecular binding fragment, which arranges as a compact U-shaped module by contacts between IG domains 1 and 4, and domains 2 and 3. The different contactins show different expression patterns in the central nervous system. During development and in adulthood, contactin-2 is transiently expressed in subsets of central and peripheral neurons. Contactin-2 is also expressed in retinal amacrine cells in the developing c Probab=14.69 E-value=83 Score=15.63 Aligned_cols=14 Identities=43% Similarity=0.750 Sum_probs=10.9 Q ss_pred CCCCCEEEEEECEE Q ss_conf 23351656640248 Q 537021.9.peg.1 22 ESWGGIYTCFNRTI 35 (38) Q Consensus 22 eswggiytcfnrti 35 (38) +.-+|.|||--+|. T Consensus 56 l~d~G~YtC~A~T~ 69 (85) T cd05854 56 LSHAGTYTCTAQTV 69 (85) T ss_pred CCCCCEEEEEEECC T ss_conf 02595999998723 No 8 >COG3947 Response regulator containing CheY-like receiver and SARP domains [Signal transduction mechanisms] Probab=12.95 E-value=1.1e+02 Score=14.98 Aligned_cols=23 Identities=30% Similarity=0.478 Sum_probs=17.7 Q ss_pred CCCCCCCCCCCEEEEEE-CEEEEC Q ss_conf 53212223351656640-248719 Q 537021.9.peg.1 16 PESRRSESWGGIYTCFN-RTIQLR 38 (38) Q Consensus 16 pesrrseswggiytcfn-rtiqlr 38 (38) -|+.++|+||-+-.||. -++++| T Consensus 117 ve~~~eee~~~~iscfgg~ev~~r 140 (361) T COG3947 117 VELTAEEESGTQISCFGGTEVVLR 140 (361) T ss_pred CCCCCHHCCCEEEEECCCEEEECC T ss_conf 444410013704675064001234 No 9 >cd05742 Ig1_VEGFR_like First immunoglobulin (Ig)-like domain of vascular endothelial growth factor (VEGF) receptor (R) and similar proteins. Ig1_VEGFR_like: first immunoglobulin (Ig)-like domain of vascular endothelial growth factor (VEGF) receptor(R) related proteins. The VEGFRs have an extracellular component with seven Ig-like domains, a transmembrane segment, and an intracellular tyrosine kinase domain interrupted by a kinase-insert domain. The VEGFR family consists of three members, VEGFR-1 (Flt-1), VEGFR-2 (KDR/Flk-1) and VEGFR-3 (Flt-4). VEGF-A interacts with both VEGFR-1 and VEGFR-2. VEGFR-1 binds strongest to VEGF, VEGF-2 binds more weakly. VEGFR-3 appears not to bind VEGF, but binds other members of the VEGF family (VEGF-C and -D). VEGFRs bind VEGFs with high affinity with the IG-like domains. VEGF-A is important to the growth and maintenance of vascular endothelial cells and to the development of new blood- and lymphatic-vessels in physiological and pathological states. VEGF Probab=11.68 E-value=1.6e+02 Score=14.15 Aligned_cols=27 Identities=26% Similarity=0.421 Sum_probs=16.6 Q ss_pred CEEEEEECCCCCCCCCCCCCCEEEEEECE Q ss_conf 11331000065321222335165664024 Q 537021.9.peg.1 6 AMVSASCSIAPESRRSESWGGIYTCFNRT 34 (38) Q Consensus 6 amvsascsiapesrrseswggiytcfnrt 34 (38) +++-.|+-+-|+-+... .|.|+|--.. T Consensus 44 ~~~~~S~LtI~~vt~~D--~G~YtC~a~~ 70 (84) T cd05742 44 ATELSSTLTIPNATLKD--SGTYTCAASS 70 (84) T ss_pred CEEEEEEEEECCCEECC--CEEEEEEEEE T ss_conf 57999999997711457--8899999987 No 10 >pfam05579 Peptidase_S32 Equine arteritis virus serine endopeptidase S32. Serine peptidases involved in processing nidovirus polyprotein. Probab=11.26 E-value=70 Score=16.01 Aligned_cols=11 Identities=64% Similarity=1.090 Sum_probs=0.0 Q ss_pred EEEEECCCCCC Q ss_conf 33100006532 Q 537021.9.peg.1 8 VSASCSIAPES 18 (38) Q Consensus 8 vsascsiapes 18 (38) ||+||.|.||| T Consensus 359 VS~Scgmt~Es 369 (426) T pfam05579 359 VSQSCGMTPES 369 (426) T ss_pred CCCCCCCCHHH T ss_conf 21235868378 Done!