BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 537021.9.peg.1086_1 (38 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >537021.9.peg.1086_1 Length = 38 Score = 80.5 bits (197), Expect = 4e-18, Method: Compositional matrix adjust. Identities = 38/38 (100%), Positives = 38/38 (100%) Query: 1 LRYKNAMVSASCSIAPESRRSESWGGIYTCFNRTIQLR 38 LRYKNAMVSASCSIAPESRRSESWGGIYTCFNRTIQLR Sbjct: 1 LRYKNAMVSASCSIAPESRRSESWGGIYTCFNRTIQLR 38 >gi|254780868|ref|YP_003065281.1| birA bifunctional protein [Candidatus Liberibacter asiaticus str. psy62] Length = 252 Score = 21.9 bits (45), Expect = 2.2, Method: Composition-based stats. Identities = 8/20 (40%), Positives = 9/20 (45%) Query: 5 NAMVSASCSIAPESRRSESW 24 N + ASC A RR W Sbjct: 40 NLWIVASCQTAGRGRRDNKW 59 >gi|254781193|ref|YP_003065606.1| putative DNA polymerase from bacteriophage origin [Candidatus Liberibacter asiaticus str. psy62] Length = 675 Score = 21.2 bits (43), Expect = 3.9, Method: Composition-based stats. Identities = 8/19 (42%), Positives = 12/19 (63%) Query: 18 SRRSESWGGIYTCFNRTIQ 36 SR SE W ++ F +TI+ Sbjct: 515 SRVSELWNELHQAFEQTIE 533 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.322 0.129 0.405 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 20,266 Number of Sequences: 1233 Number of extensions: 304 Number of successful extensions: 3 Number of sequences better than 100.0: 3 Number of HSP's better than 100.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of query: 38 length of database: 328,796 effective HSP length: 12 effective length of query: 26 effective length of database: 314,000 effective search space: 8164000 effective search space used: 8164000 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.5 bits) S2: 31 (16.5 bits)