RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= 537021.9.peg.109_1 (66 letters) >gnl|CDD|33099 COG3290, CitA, Signal transduction histidine kinase regulating citrate/malate metabolism [Signal transduction mechanisms]. Length = 537 Score = 26.0 bits (57), Expect = 2.2 Identities = 13/55 (23%), Positives = 19/55 (34%) Query: 12 ITLSHFAQWFLQFSVSLLLSADISASVLFPVYWILPGFDFRKILSLRDYILCRLA 66 LS L+F L L + + WIL R++L L + L Sbjct: 160 YLLSEIDDVILEFLRPLALIVVLGLLIGLLGAWILARHIKRQMLGLEPEEIATLL 214 >gnl|CDD|37526 KOG2315, KOG2315, KOG2315, Predicted translation initiation factor related to eIF-3a [Translation, ribosomal structure and biogenesis]. Length = 566 Score = 24.9 bits (54), Expect = 4.4 Identities = 9/42 (21%), Positives = 17/42 (40%), Gaps = 2/42 (4%) Query: 10 FSITLSHFAQWFLQFSVSLLLSADISASVLFPVYWILPGFDF 51 I W QFS+ L+A + ++ + ++ L F Sbjct: 119 SQIQKKMQNGWVPQFSIDESLAARLVSNEVQ--FYDLGSFKT 158 >gnl|CDD|37813 KOG2602, KOG2602, KOG2602, Predicted cell surface protein homologous to bacterial outer membrane proteins [General function prediction only]. Length = 457 Score = 24.6 bits (53), Expect = 6.7 Identities = 9/41 (21%), Positives = 13/41 (31%), Gaps = 1/41 (2%) Query: 20 WFLQFSVSLLLSADISASVLFPVY-WILPGFDFRKILSLRD 59 Q S S D+ S P + + F I +D Sbjct: 150 LSGQVSYGCTRSTDMGLSFYKPRFHGLKTPFSSFSIFRTQD 190 >gnl|CDD|119357 cd02878, GH18_zymocin_alpha, Zymocin, alpha subunit. Zymocin is a heterotrimeric enzyme that inhibits yeast cell cycle progression. The zymocin alpha subunit has a chitinase activity that is essential for holoenzyme action from the cell exterior while the gamma subunit contains the intracellular toxin responsible for G1 phase cell cycle arrest. The zymocin alpha and beta subunits are thought to act from the cell's exterior by docking to the cell wall-associated chitin, thus mediating gamma-toxin translocation. The alpha subunit has an eight-stranded TIM barrel fold similar to that of family 18 glycosyl hydrolases such as hevamine, chitolectin, and chitobiase.. Length = 345 Score = 24.2 bits (53), Expect = 7.3 Identities = 15/44 (34%), Positives = 21/44 (47%), Gaps = 3/44 (6%) Query: 21 FLQFSVSL--LLSADISASVLFPV-YWILPGFDFRKILSLRDYI 61 +L+F L L + S S+ P YW L GF + + DYI Sbjct: 137 YLEFLKLLKSKLPSGKSLSIAAPASYWYLKGFPIKDMAKYVDYI 180 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.339 0.147 0.479 Gapped Lambda K H 0.267 0.0806 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 841,216 Number of extensions: 32949 Number of successful extensions: 153 Number of sequences better than 10.0: 1 Number of HSP's gapped: 153 Number of HSP's successfully gapped: 22 Length of query: 66 Length of database: 6,263,737 Length adjustment: 37 Effective length of query: 29 Effective length of database: 5,464,204 Effective search space: 158461916 Effective search space used: 158461916 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 39 (21.8 bits) S2: 51 (23.3 bits)