Query 537021.9.peg.1090_1 Match_columns 38 No_of_seqs 1 out of 3 Neff 1.0 Searched_HMMs 39220 Date Wed May 25 08:42:01 2011 Command /home/congqian_1/programs/hhpred/hhsearch -i peg_1090.hhm -d /home/congqian_1/database/cdd/Cdd.hhm No Hit Prob E-value P-value Score SS Cols Query HMM Template HMM 1 TIGR00934 2a38euk potassium up 52.8 8.2 0.00021 20.0 1.7 19 7-25 1086-1104(1197) 2 TIGR00739 yajC preprotein tran 36.3 37 0.00093 16.6 2.9 25 9-33 11-35 (86) 3 pfam04272 Phospholamban Phosph 22.6 52 0.0013 15.8 1.7 15 9-24 34-48 (52) 4 KOG3025 consensus 19.8 68 0.0017 15.2 1.8 13 7-19 122-134 (137) 5 TIGR01601 PYST-C1 Plasmodium y 19.3 64 0.0016 15.3 1.6 12 8-19 7-18 (86) 6 COG2892 Uncharacterized protei 18.1 91 0.0023 14.5 2.2 20 12-31 62-81 (82) 7 COG5153 CVT17 Putative lipase 16.8 82 0.0021 14.8 1.7 21 8-28 12-32 (425) 8 KOG4540 consensus 16.8 82 0.0021 14.8 1.7 21 8-28 12-32 (425) 9 PRK05362 phosphopentomutase; P 16.0 99 0.0025 14.3 1.9 16 17-32 176-191 (393) 10 KOG4804 consensus 13.9 1.2E+02 0.0031 13.9 2.0 33 3-35 40-75 (243) No 1 >TIGR00934 2a38euk potassium uptake protein, Trk family; InterPro: IPR004773 The proteins of the Trk family are derived from Gram-negative and Gram-positive bacteria, yeast and Triticum aestivum (Wheat). The proteins of Escherichia coli K12 TrkH and TrkG as well as several yeast proteins have been functionally characterised. The E. coli TrkH and TrkG proteins are complexed to two peripheral membrane proteins, TrkA, an NAD-binding protein, and TrkE, an ATP-binding protein. This complex forms the potassium uptake system. This family is specific for the eukaryotic Trk system.; GO: 0015079 potassium ion transmembrane transporter activity, 0006813 potassium ion transport, 0016021 integral to membrane. Probab=52.78 E-value=8.2 Score=20.04 Aligned_cols=19 Identities=42% Similarity=0.854 Sum_probs=17.1 Q ss_pred HHHHHHHHHHHHHHHHHHH Q ss_conf 2699999999999999999 Q 537021.9.peg.1 7 DPLFCLILYFLLLKICENV 25 (38) Q Consensus 7 dplfclilyflllkicenv 25 (38) |||.|++|.+.++-|||.- T Consensus 1086 dPLWy~~LglFiiCIcEg~ 1104 (1197) T TIGR00934 1086 DPLWYLFLGLFIICICEGR 1104 (1197) T ss_pred CHHHHHHHHHHHHHHCCCC T ss_conf 5378999999998632553 No 2 >TIGR00739 yajC preprotein translocase, YajC subunit; InterPro: IPR003849 This entry describes proteins of unknown function.. Probab=36.27 E-value=37 Score=16.62 Aligned_cols=25 Identities=36% Similarity=0.664 Sum_probs=17.8 Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHH Q ss_conf 9999999999999999999999999 Q 537021.9.peg.1 9 LFCLILYFLLLKICENVRKIVKSMV 33 (38) Q Consensus 9 lfclilyflllkicenvrkivksmv 33 (38) ++-++.|||+..--+.-||-.+.|. T Consensus 11 ~~~~~FYFl~~RPQ~K~~k~~~kl~ 35 (86) T TIGR00739 11 LIFLIFYFLIIRPQRKRRKAHKKLI 35 (86) T ss_pred HHHHHHHHHHCCHHHHHHHHHHHHH T ss_conf 9999999970497798889888888 No 3 >pfam04272 Phospholamban Phospholamban. The regulation of calcium levels across the membrane of the sarcoplasmic reticulum involves the interplay of many membrane proteins. Phospholamban is a 52 residue integral membrane protein that is involved in reversibly inhibiting the Ca(2+) pump and regulating the flow of Ca ions across the sarcoplasmic reticulum membrane during muscle contraction and relaxation. Phospholamban is thought to form a pentamer in the membrane. Probab=22.60 E-value=52 Score=15.83 Aligned_cols=15 Identities=67% Similarity=1.065 Sum_probs=10.0 Q ss_pred HHHHHHHHHHHHHHHH Q ss_conf 9999999999999999 Q 537021.9.peg.1 9 LFCLILYFLLLKICEN 24 (38) Q Consensus 9 lfclilyflllkicen 24 (38) -|||||.-||| ||-- T Consensus 34 nfcliliclll-icii 48 (52) T pfam04272 34 NFCLILICLLL-ICII 48 (52) T ss_pred HHHHHHHHHHH-HHHH T ss_conf 99999999999-9999 No 4 >KOG3025 consensus Probab=19.82 E-value=68 Score=15.18 Aligned_cols=13 Identities=54% Similarity=1.070 Sum_probs=10.6 Q ss_pred HHHHHHHHHHHHH Q ss_conf 2699999999999 Q 537021.9.peg.1 7 DPLFCLILYFLLL 19 (38) Q Consensus 7 dplfclilyflll 19 (38) --||||.+-||++ T Consensus 122 ~glfclm~aflil 134 (137) T KOG3025 122 MGLFCLMVAFLIL 134 (137) T ss_pred HHHHHHHHHHHHH T ss_conf 8089999999999 No 5 >TIGR01601 PYST-C1 Plasmodium yoelii subtelomeric domain PYST-C1; InterPro: IPR006488 This group of sequences are defined by the N-terminal domain of a paralogous family of Plasmodium yoelii genes preferentially located in the subtelomeric regions of the chromosomes. There are no obvious homologs to these genes in any other organism. The C-terminal portions of the genes that contain this domain are divergent and some contain other yoelii-specific paralogous domains such as PYST-C2 (IPR006491 from INTERPRO). . Probab=19.30 E-value=64 Score=15.33 Aligned_cols=12 Identities=50% Similarity=1.151 Sum_probs=9.1 Q ss_pred HHHHHHHHHHHH Q ss_conf 699999999999 Q 537021.9.peg.1 8 PLFCLILYFLLL 19 (38) Q Consensus 8 plfclilyflll 19 (38) -|.|..||.||- T Consensus 7 SLVcIvLY~lla 18 (86) T TIGR01601 7 SLVCIVLYILLA 18 (86) T ss_pred HHHHHHHHHHHC T ss_conf 688999999871 No 6 >COG2892 Uncharacterized protein conserved in archaea [Function unknown] Probab=18.12 E-value=91 Score=14.52 Aligned_cols=20 Identities=25% Similarity=0.468 Sum_probs=15.9 Q ss_pred HHHHHHHHHHHHHHHHHHHH Q ss_conf 99999999999999999999 Q 537021.9.peg.1 12 LILYFLLLKICENVRKIVKS 31 (38) Q Consensus 12 lilyflllkicenvrkivks 31 (38) +--||.++|+|.++-++.++ T Consensus 62 ~nS~lRlI~~a~~vi~i~~~ 81 (82) T COG2892 62 INSYLRLIKVAQEVIEISAT 81 (82) T ss_pred HHHHHHHHHHHHHHHHHHCC T ss_conf 99999999999999998706 No 7 >COG5153 CVT17 Putative lipase essential for disintegration of autophagic bodies inside the vacuole [Intracellular trafficking and secretion / Lipid metabolism] Probab=16.80 E-value=82 Score=14.77 Aligned_cols=21 Identities=38% Similarity=0.621 Sum_probs=15.8 Q ss_pred HHHHHHHHHHHHHHHHHHHHH Q ss_conf 699999999999999999999 Q 537021.9.peg.1 8 PLFCLILYFLLLKICENVRKI 28 (38) Q Consensus 8 plfclilyflllkicenvrki 28 (38) .|||+|.|+.-+..-+.|-|- T Consensus 12 ~l~c~i~~~~~~~~~~sv~ks 32 (425) T COG5153 12 TLLCLIAYYFALPDYLSVGKS 32 (425) T ss_pred HHHHHHHHHHHCHHHHHHCCC T ss_conf 999999999733037664143 No 8 >KOG4540 consensus Probab=16.80 E-value=82 Score=14.77 Aligned_cols=21 Identities=38% Similarity=0.621 Sum_probs=15.8 Q ss_pred HHHHHHHHHHHHHHHHHHHHH Q ss_conf 699999999999999999999 Q 537021.9.peg.1 8 PLFCLILYFLLLKICENVRKI 28 (38) Q Consensus 8 plfclilyflllkicenvrki 28 (38) .|||+|.|+.-+..-+.|-|- T Consensus 12 ~l~c~i~~~~~~~~~~sv~ks 32 (425) T KOG4540 12 TLLCLIAYYFALPDYLSVGKS 32 (425) T ss_pred HHHHHHHHHHHCHHHHHHCCC T ss_conf 999999999733037664143 No 9 >PRK05362 phosphopentomutase; Provisional Probab=16.05 E-value=99 Score=14.33 Aligned_cols=16 Identities=38% Similarity=0.652 Sum_probs=12.8 Q ss_pred HHHHHHHHHHHHHHHH Q ss_conf 9999999999999999 Q 537021.9.peg.1 17 LLLKICENVRKIVKSM 32 (38) Q Consensus 17 lllkicenvrkivksm 32 (38) -|.++|+-+|+++... T Consensus 176 ~Ly~~c~~aR~il~~~ 191 (393) T PRK05362 176 ELYRICEIAREILDDR 191 (393) T ss_pred HHHHHHHHHHHHHCCC T ss_conf 9999999999985056 No 10 >KOG4804 consensus Probab=13.94 E-value=1.2e+02 Score=13.86 Aligned_cols=33 Identities=27% Similarity=0.535 Sum_probs=20.1 Q ss_pred HHHHHHHHHHHHHHHHHHH---HHHHHHHHHHHHHH Q ss_conf 6550269999999999999---99999999999989 Q 537021.9.peg.1 3 FAMCDPLFCLILYFLLLKI---CENVRKIVKSMVFL 35 (38) Q Consensus 3 famcdplfclilyflllki---cenvrkivksmvfl 35 (38) +--|-|.|||..|...-.+ -|.-..|....||- T Consensus 40 l~KclPIf~Lv~fl~a~g~gl~~~~~t~i~~GLvfs 75 (243) T KOG4804 40 LWKCLPIFCLVAFLYANGGGLGKEQRTTILAGLVFS 75 (243) T ss_pred HHHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHC T ss_conf 999999999999999818764772166888766543 Done!