Query 537021.9.peg.1096_1 Match_columns 53 No_of_seqs 1 out of 3 Neff 1.0 Searched_HMMs 39220 Date Wed May 25 08:35:20 2011 Command /home/congqian_1/programs/hhpred/hhsearch -i peg_1096.hhm -d /home/congqian_1/database/cdd/Cdd.hhm No Hit Prob E-value P-value Score SS Cols Query HMM Template HMM 1 KOG4501 consensus 48.5 21 0.00053 17.9 3.2 45 8-52 56-100 (707) 2 pfam05473 Herpes_UL45 UL45 pro 40.9 30 0.00076 17.2 3.0 24 27-50 41-64 (191) 3 TIGR01107 Na_K_ATPase_bet Na+/ 38.8 25 0.00065 17.5 2.4 22 26-47 45-68 (317) 4 COG5374 Uncharacterized conser 27.1 62 0.0016 15.6 3.0 23 23-45 46-70 (192) 5 KOG4181 consensus 24.3 9.4 0.00024 19.6 -1.8 41 2-42 270-310 (491) 6 CHL00036 ycf4 photosystem I as 22.7 77 0.002 15.1 2.7 34 10-48 10-43 (184) 7 pfam02392 Ycf4 Ycf4. This fami 20.9 84 0.0021 14.9 2.7 34 10-48 7-40 (180) 8 KOG1962 consensus 13.4 1.3E+02 0.0034 14.0 3.4 34 12-45 30-67 (216) 9 KOG0896 consensus 12.2 67 0.0017 15.4 0.2 14 10-23 49-62 (138) 10 TIGR02317 prpB methylisocitrat 10.8 88 0.0022 14.8 0.4 15 3-17 210-224 (287) No 1 >KOG4501 consensus Probab=48.51 E-value=21 Score=17.93 Aligned_cols=45 Identities=27% Similarity=0.341 Sum_probs=32.1 Q ss_pred CCHHHCCHHHEEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCC Q ss_conf 443222612323201355899999999999998999877631235 Q 537021.9.peg.1 8 YSADKISESRIFSLKYADHIFYCCMIFIGVIDGVVRSISSLCFPY 52 (53) Q Consensus 8 ysadkisesrifslkyadhifyccmifigvidgvvrsisslcfpy 52 (53) .+|.-|+++--|-|....|-|+|-|||--.....+-|.-.+.-|| T Consensus 56 ~~an~i~~dl~~lLsLphh~fwcqvI~de~~~~c~~s~l~~v~~~ 100 (707) T KOG4501 56 KSANGISEDLNMLLSLPHHFFWCQVILDEMHHRCTSSLLTLVSSA 100 (707) T ss_pred HHHHCCHHHHHHHHHCHHHHHHHHHHHHHHHHHHHHHHHHHCCCC T ss_conf 873041020899984415777899999999999999999873742 No 2 >pfam05473 Herpes_UL45 UL45 protein. This family consists several UL45 proteins. The herpes simplex virus UL45 gene encodes an 18 kDa virion envelope protein whose function remains unknown. It has been suggested that the 18 kDa UL45 gene product is required for efficient growth in the central nervous system at low doses and may play an important role under the conditions of a naturally acquired infection. This family also contains several Varicellovirus UL45 or gene 15 proteins. The Equine herpesvirus 1 UL45 protein represents a type II membrane glycoprotein which has found to be non-essential for EHV-1 growth in vitro but deletion reduces the viruses' replication efficiency. Probab=40.89 E-value=30 Score=17.15 Aligned_cols=24 Identities=21% Similarity=0.333 Sum_probs=19.3 Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHC Q ss_conf 999999999999989998776312 Q 537021.9.peg.1 27 IFYCCMIFIGVIDGVVRSISSLCF 50 (53) Q Consensus 27 ifyccmifigvidgvvrsisslcf 50 (53) .|-|||+++||+-++.--++.+-| T Consensus 41 ~~~lg~~~~Gvllt~~vIvat~vf 64 (191) T pfam05473 41 LFTLGGFAIGVLLTMFVIVATFVF 64 (191) T ss_pred HHHHHHHHHHHHHHHHHHHHHHEE T ss_conf 577778999999999999866402 No 3 >TIGR01107 Na_K_ATPase_bet Na+/K+ ATPase, beta subunit; InterPro: IPR000402 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane. ATPases can harness the energy from a proton gradient, using the flux of ions across the membrane via the ATPase proton channel to drive the synthesis of ATP. Some ATPases work in reverse, using the energy from the hydrolysis of ATP to create a proton gradient. There are different types of ATPases, which can differ in function (ATP synthesis and/or hydrolysis), structure (F-, V- and A-ATPases contain rotary motors) and in the type of ions they transport , . F-ATPases (F1F0-ATPases) in mitochondria, chloroplasts and bacterial plasma membranes are the prime producers of ATP, using the proton gradient generated by oxidative phosphorylation (mitochondria) or photosynthesis (chloroplasts). V-ATPases (V1V0-ATPases) are primarily found in eukaryotic vacuoles, catalysing ATP hydrolysis to transport solutes and lower pH in organelles. A-ATPases (A1A0-ATPases) are found in Archaea and function like F-ATPases. P-ATPases (E1E2-ATPases) are found in bacteria and in eukaryotic plasma membranes and organelles, and function to transport a variety of different ions across membranes. E-ATPases are cell-surface enzymes that hydrolyse a range of NTPs, including extracellular ATP. P-ATPases (sometime known as E1-E2 ATPases) (3.6.3.- from EC) are found in bacteria and in a number of eukaryotic plasma membranes and organelles . P-ATPases function to transport a variety of different compounds, including ions and phospholipids, across a membrane using ATP hydrolysis for energy. There are many different classes of P-ATPases, each of which transports a specific type of ion: H^+, Na^+, K^+, Mg^2+, Ca^2+, Ag^+ and Ag^2+, Zn^2+, Co^2+, Pb^2+, Ni^2+, Cd^2+, Cu^+ and Cu^2+. P-ATPases can be composed of one or two polypeptides, and can usually assume two main conformations called E1 and E2. This entry represents the beta subunit found in the P-type cation exchange ATPases located in the plasma membranes of animal cells. These P-ATPases include both H^+/K^+-ATPases (3.6.3.10 from EC) and Na^+/K^+-ATPases (3.6.3.9 from EC), which belong to the IIC subfamily of ATPases , . These ATPases catalyse the hydrolysis of ATP coupled with the exchange of cations, pumping one cation out of the cell (H^+ or Na^+) in exchange for K^+. These ATPases contain an alpha subunit (IPR005775 from INTERPRO) that is the catalytic component, and a glycosylated beta subunit that regulates the number of sodium pumps transported to the plasma membrane through the assembly of alpha/beta heterodimers. The beta subunit has three highly conserved disulphide bonds within the extracellular domain that stabilize the alpha subunit, the alpha/beta interaction, and the catalytic activity of the alpha subunit . Different beta isoforms exist, permitting greater regulatory control. An example of a H^+/K^+-ATPase is the gastric pump responsible for acid secretion in the stomach, transporting protons from the cytoplasm of parietal cells to create a large pH gradient in exchange for the internalization of potassium ions, using ATP hydrolysis to drive the pump . More information about this protein can be found at Protein of the Month: ATP Synthases . ; GO: 0005391 sodium:potassium-exchanging ATPase activity, 0006813 potassium ion transport, 0006814 sodium ion transport, 0016020 membrane. Probab=38.79 E-value=25 Score=17.49 Aligned_cols=22 Identities=41% Similarity=0.904 Sum_probs=17.5 Q ss_pred HHHHHHH--HHHHHHHHHHHHHHH Q ss_conf 8999999--999999989998776 Q 537021.9.peg.1 26 HIFYCCM--IFIGVIDGVVRSISS 47 (53) Q Consensus 26 hifyccm--ifigvidgvvrsiss 47 (53) -|||-|| ||||.|--..-.||. T Consensus 45 l~FYG~LAglF~~Ti~VmLlT~~d 68 (317) T TIGR01107 45 LVFYGCLAGLFIGTIQVMLLTISD 68 (317) T ss_pred HHHHHHHHHHHHHHHHHHHHCCCC T ss_conf 999999999999999998610366 No 4 >COG5374 Uncharacterized conserved protein [Function unknown] Probab=27.05 E-value=62 Score=15.58 Aligned_cols=23 Identities=35% Similarity=0.353 Sum_probs=17.3 Q ss_pred HHHHHHHHHHHHHHH--HHHHHHHH Q ss_conf 355899999999999--99899987 Q 537021.9.peg.1 23 YADHIFYCCMIFIGV--IDGVVRSI 45 (53) Q Consensus 23 yadhifyccmifigv--idgvvrsi 45 (53) --.||.+|-++|||+ ||.+-|-+ T Consensus 46 ~~k~il~i~~~~IllLFiDS~~Rv~ 70 (192) T COG5374 46 GFKHILKITFIFILLLFIDSWKRVY 70 (192) T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHH T ss_conf 1587999999999999999867763 No 5 >KOG4181 consensus Probab=24.33 E-value=9.4 Score=19.62 Aligned_cols=41 Identities=24% Similarity=0.373 Sum_probs=27.2 Q ss_pred CCCCCCCCHHHCCHHHEEEHHHHHHHHHHHHHHHHHHHHHH Q ss_conf 85677544322261232320135589999999999999899 Q 537021.9.peg.1 2 DRKKPYYSADKISESRIFSLKYADHIFYCCMIFIGVIDGVV 42 (53) Q Consensus 2 drkkpyysadkisesrifslkyadhifyccmifigvidgvv 42 (53) |++++---.-.-+..-..||.-+...||.|-|.|-|+||.. T Consensus 270 d~p~~~~~~~d~~~~~~~sL~~~AfLl~VcHivivV~d~~~ 310 (491) T KOG4181 270 DTPPLMPVGKDSDHQDLYSLGTMAFLLSVCHIVIVVIDGLA 310 (491) T ss_pred CCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHEEEEEECCHH T ss_conf 78889888988417889999999999987617899842123 No 6 >CHL00036 ycf4 photosystem I assembly protein Ycf4 Probab=22.70 E-value=77 Score=15.14 Aligned_cols=34 Identities=29% Similarity=0.530 Sum_probs=26.9 Q ss_pred HHHCCHHHEEEHHHHHHHHHHHHHHHHHHHHHHHHHHHH Q ss_conf 322261232320135589999999999999899987763 Q 537021.9.peg.1 10 ADKISESRIFSLKYADHIFYCCMIFIGVIDGVVRSISSL 48 (53) Q Consensus 10 adkisesrifslkyadhifyccmifigvidgvvrsissl 48 (53) -+.|..||-+| ..|+++++++|-+.=..-++||- T Consensus 10 ~~~I~GSRr~S-----N~~wA~il~lG~lGFll~g~SSY 43 (184) T CHL00036 10 IELITGSRRIS-----NFFWAFILFLGSLGFLLVGISSY 43 (184) T ss_pred EEEECCCCHHH-----HHHHHHHHHHHHHHHHHHHHHHH T ss_conf 98633564045-----77899999875599998776897 No 7 >pfam02392 Ycf4 Ycf4. This family consists of hypothetical Ycf4 proteins from various chloroplast genomes. It has been suggested that Ycf4 is involved in the assembly and/or stability of the photosystem I complex in chloroplasts. Probab=20.90 E-value=84 Score=14.94 Aligned_cols=34 Identities=29% Similarity=0.491 Sum_probs=26.7 Q ss_pred HHHCCHHHEEEHHHHHHHHHHHHHHHHHHHHHHHHHHHH Q ss_conf 322261232320135589999999999999899987763 Q 537021.9.peg.1 10 ADKISESRIFSLKYADHIFYCCMIFIGVIDGVVRSISSL 48 (53) Q Consensus 10 adkisesrifslkyadhifyccmifigvidgvvrsissl 48 (53) -+.|..||-+| ..|+++++++|-+.=..-++||- T Consensus 7 ~~~I~GSRR~S-----Ny~wA~i~~~G~lGFll~g~SSY 40 (180) T pfam02392 7 REPILGSRRFS-----NYFWASILLLGGLGFLLVGISSY 40 (180) T ss_pred EEEECCCCHHH-----HHHHHHHHHHHHHHHHHHHHHHH T ss_conf 99724664146-----88999999875599999887897 No 8 >KOG1962 consensus Probab=13.37 E-value=1.3e+02 Score=13.96 Aligned_cols=34 Identities=32% Similarity=0.191 Sum_probs=21.6 Q ss_pred HCCHHHEEEH--HHHHHHHHHHHHHHH--HHHHHHHHH Q ss_conf 2261232320--135589999999999--999899987 Q 537021.9.peg.1 12 KISESRIFSL--KYADHIFYCCMIFIG--VIDGVVRSI 45 (53) Q Consensus 12 kisesrifsl--kyadhifyccmifig--vidgvvrsi 45 (53) ++.-++..+. +.+.|+++|-|++|+ .||.+.|.- T Consensus 30 ~~~~~~~~~~~~~~~~~~i~~~~~villlfiDsvr~i~ 67 (216) T KOG1962 30 KIFKDRLKSGLAPQVLKTIATTMIVILLLFIDSVRRIQ 67 (216) T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH T ss_conf 99999998743038999999999999999999999999 No 9 >KOG0896 consensus Probab=12.19 E-value=67 Score=15.42 Aligned_cols=14 Identities=43% Similarity=0.660 Sum_probs=10.7 Q ss_pred HHHCCHHHEEEHHH Q ss_conf 32226123232013 Q 537021.9.peg.1 10 ADKISESRIFSLKY 23 (53) Q Consensus 10 adkisesrifslky 23 (53) +.++-|.||+|||- T Consensus 49 prT~~EnRiysLKI 62 (138) T KOG0896 49 PRTMYENRIYSLKI 62 (138) T ss_pred CCCCCCCCEEEEEE T ss_conf 98643343256887 No 10 >TIGR02317 prpB methylisocitrate lyase; InterPro: IPR012695 Propionate is the second most abundant low molecular mass carbon source found in soil, being generated by the degradation of several amino acids, fementation of crabohydrates and the oxidation of odd-chain fatty acids. Many different organisms are capable of metabolising propionate and several distinct pathways for utilising this compound exist, all of which begin with its activation to propionyl-CoA . Many bacteria metabolise propionate to pyruvate by the 2-methylcitric acid cycle. In the first step, catalysed by methycitrate synthase, oxaloacetate and propionyl-CoA are condensed to form 2-methylcitrate and CoA. The 2-methylcitrate is subsequently converted to 2-methylisocitrate by the combined actions of a dehydratase and an aconitase. In the final step, 2-methylisocitrate lyase cleaves a C-C bond within this compound to form succinate and pyruvate. The succinate is further oxidised to oxaloacetate which re-enters the cycle, while the pyruvate can be used further for either energy generation or biomass synthesis. Proteins in this entry are mostly 2-methylisocitrate lyases. Some of them have been annotated (incorrectly it seems) as the related protein carboxyphosphoenolpyruvate phosphomutase, which is involved in synthesizing the antibiotic bialaphos in Streptomyces hygroscopicus. Structural studies indicate that these enzymes belong to the isocitrate lyase family, binding a Mg(2+) cofactor and forming a TIM barrel fold , . As with other enzymes in this family, substrate-binding induces a conformational change that prevents solvent access to the active site and which is important for catalysis. . Probab=10.77 E-value=88 Score=14.85 Aligned_cols=15 Identities=40% Similarity=0.687 Sum_probs=11.9 Q ss_pred CCCCCCCHHHCCHHH Q ss_conf 567754432226123 Q 537021.9.peg.1 3 RKKPYYSADKISESR 17 (53) Q Consensus 3 rkkpyysadkisesr 17 (53) -|-|||++|..+|-- T Consensus 210 GKTPl~t~deL~~~G 224 (287) T TIGR02317 210 GKTPLYTADELREIG 224 (287) T ss_pred CCCCCCCHHHHHHCC T ss_conf 676456579896489 Done!