RPS-BLAST 2.2.22 [Sep-27-2009]

Database: CddB 
           21,608 sequences; 5,994,473 total letters

Searching..................................................done

Query= 537021.9.peg.1096_1
         (53 letters)



>gnl|CDD|178219 PLN02609, PLN02609, catalase.
          Length = 492

 Score = 27.4 bits (61), Expect = 0.83
 Identities = 11/19 (57%), Positives = 15/19 (78%), Gaps = 2/19 (10%)

Query: 7   YYSADKISESRIFSLKYAD 25
           YYS DK+ ++RIF+  YAD
Sbjct: 334 YYSDDKLLQTRIFA--YAD 350


>gnl|CDD|180260 PRK05788, PRK05788, cobalamin biosynthesis protein CbiG;
          Validated.
          Length = 315

 Score = 26.0 bits (58), Expect = 2.4
 Identities = 11/44 (25%), Positives = 18/44 (40%), Gaps = 4/44 (9%)

Query: 7  YYSADKISESRIFSLKYADHIF--YCCMIFIGVIDGVVRSISSL 48
           Y+++K+           +  F  Y  +IFI      VR I+ L
Sbjct: 30 CYTSEKLEYEGFADA--FEEAFGCYDALIFIMATGIAVRVIAPL 71


  Database: CddB
    Posted date:  Feb 4, 2011  9:54 PM
  Number of letters in database: 5,994,473
  Number of sequences in database:  21,608
  
Lambda     K      H
   0.333    0.148    0.472 

Gapped
Lambda     K      H
   0.267   0.0653    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 21608
Number of Hits to DB: 826,799
Number of extensions: 33711
Number of successful extensions: 118
Number of sequences better than 10.0: 1
Number of HSP's gapped: 118
Number of HSP's successfully gapped: 8
Length of query: 53
Length of database: 5,994,473
Length adjustment: 26
Effective length of query: 27
Effective length of database: 5,432,665
Effective search space: 146681955
Effective search space used: 146681955
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 39 (21.5 bits)
S2: 50 (23.2 bits)