Query 537021.9.peg.1101_1 Match_columns 37 No_of_seqs 1 out of 3 Neff 1.0 Searched_HMMs 39220 Date Wed May 25 07:05:34 2011 Command /home/congqian_1/programs/hhpred/hhsearch -i peg_1101.hhm -d /home/congqian_1/database/cdd/Cdd.hhm No Hit Prob E-value P-value Score SS Cols Query HMM Template HMM 1 TIGR01198 pgl 6-phosphoglucono 30.7 22 0.00057 18.8 1.0 17 5-21 55-75 (251) 2 pfam07316 DUF1463 Protein of u 29.8 44 0.0011 17.4 2.4 29 4-32 4-34 (140) 3 PRK10106 hypothetical protein; 24.1 33 0.00085 17.9 1.0 22 12-33 26-48 (65) 4 cd03377 TPP_PFOR_PNO Thiamine 20.3 41 0.0011 17.5 0.8 18 10-27 24-41 (365) 5 TIGR02036 dsdC D-serine deamin 19.1 46 0.0012 17.2 0.8 16 8-25 146-161 (302) 6 KOG2849 consensus 16.7 58 0.0015 16.8 0.9 13 3-15 277-289 (388) 7 cd06405 PB1_Mekk2_3 The PB1 do 15.5 55 0.0014 16.9 0.5 25 3-29 34-58 (79) 8 pfam10383 Clr2 Transcription-s 14.7 77 0.002 16.2 1.1 11 8-18 5-15 (133) 9 TIGR02199 rfaE_dom_II rfaE bif 14.4 21 0.00052 19.0 -1.9 10 28-37 26-35 (144) 10 pfam06852 DUF1248 Protein of u 13.3 66 0.0017 16.5 0.4 15 10-24 144-158 (180) No 1 >TIGR01198 pgl 6-phosphogluconolactonase; InterPro: IPR005900 6-phosphogluconolactonase (3.1.1.31 from EC) is the enzyme responsible for the hydrolysis of 6-phosphogluconolactone to 6-phosphogluconate, the second step in the pentose phosphate pathway.6-phospho-D-glucono-1,5-lactone + H2O = 6-phospho-D-gluconate. ; GO: 0017057 6-phosphogluconolactonase activity, 0006098 pentose-phosphate shunt. Probab=30.65 E-value=22 Score=18.80 Aligned_cols=17 Identities=41% Similarity=1.030 Sum_probs=13.9 Q ss_pred CCCE----EEECCCEEECCCC Q ss_conf 2204----8964613201110 Q 537021.9.peg.1 5 SLDW----IYFGDEMIIPKKL 21 (37) Q Consensus 5 sldw----iyfgdemiipkkl 21 (37) .+|| |+||||-++|.-- T Consensus 55 ~~~W~~~~~~l~DER~VP~~h 75 (251) T TIGR01198 55 KLDWSRIHLFLGDERYVPLDH 75 (251) T ss_pred CCCCCCEEEEEEEEEECCCCC T ss_conf 588021578863232147988 No 2 >pfam07316 DUF1463 Protein of unknown function (DUF1463). This family consists of several hypothetical bacterial proteins of around 140 residues in length. Members of this family seem to be found exclusively in Borrelia burgdorferi (Lyme disease spirochete). The function of this family is unknown. Probab=29.82 E-value=44 Score=17.35 Aligned_cols=29 Identities=45% Similarity=0.594 Sum_probs=22.9 Q ss_pred CCCCEEEE--CCCEEECCCCCCCCCCCCEEE Q ss_conf 22204896--461320111002435660244 Q 537021.9.peg.1 4 KSLDWIYF--GDEMIIPKKLECSSDLNHVSY 32 (37) Q Consensus 4 ksldwiyf--gdemiipkklecssdlnhvsy 32 (37) -|||-||| ||..|-..|||-||.-|...- T Consensus 4 YsL~~ifFS~~~~~i~sGkLe~sseP~t~A~ 34 (140) T pfam07316 4 YDLDEIFFSFGDNLIDSGKLELSSEPNTMAK 34 (140) T ss_pred EEEEEEEEEECCEEEECCEEEECCCCCEEEE T ss_conf 4414899985776841160786158844655 No 3 >PRK10106 hypothetical protein; Provisional Probab=24.11 E-value=33 Score=17.93 Aligned_cols=22 Identities=36% Similarity=0.457 Sum_probs=15.5 Q ss_pred CCCEEECCCCC-CCCCCCCEEEE Q ss_conf 46132011100-24356602443 Q 537021.9.peg.1 12 GDEMIIPKKLE-CSSDLNHVSYL 33 (37) Q Consensus 12 gdemiipkkle-cssdlnhvsyl 33 (37) .|.||+|..-+ -.-|+||.+-- T Consensus 26 rd~mi~P~~~~~sP~Dlnhm~aG 48 (65) T PRK10106 26 RDVMVVPPSQEQPPFDLNHMGTG 48 (65) T ss_pred CCEEECCCCCCCCCCCCCCCCCC T ss_conf 86188072246896554554367 No 4 >cd03377 TPP_PFOR_PNO Thiamine pyrophosphate (TPP family), PFOR_PNO subfamily, TPP-binding module; composed of proteins similar to the single subunit pyruvate ferredoxin oxidoreductase (PFOR) of Desulfovibrio Africanus, present in bacteria and amitochondriate eukaryotes. This subfamily also includes proteins characterized as pyruvate NADP+ oxidoreductase (PNO). These enzymes are dependent on TPP and a divalent metal cation as cofactors. PFOR and PNO catalyze the oxidative decarboxylation of pyruvate to form acetyl-CoA, a crucial step in many metabolic pathways. Archaea, anaerobic bacteria and eukaryotes that lack mitochondria (and therefore pyruvate dehydrogenase) use PFOR to oxidatively decarboxylate pyruvate, with ferredoxin or flavodoxin as the electron acceptor. The PFOR from cyanobacterium Anabaena (NifJ) is required for the transfer of electrons from pyruvate to flavodoxin, which reduces nitrogenase. The facultative anaerobic mitochondrion of the photosynthetic protist Euglena gra Probab=20.33 E-value=41 Score=17.47 Aligned_cols=18 Identities=44% Similarity=0.755 Sum_probs=15.6 Q ss_pred EECCCEEECCCCCCCCCC Q ss_conf 964613201110024356 Q 537021.9.peg.1 10 YFGDEMIIPKKLECSSDL 27 (37) Q Consensus 10 yfgdemiipkklecssdl 27 (37) -|||.|+|-.-.-|||-. T Consensus 24 LFGdRm~IANATGCssI~ 41 (365) T cd03377 24 LFGDRMVIANATGCSSIY 41 (365) T ss_pred HCCCCEEEEECCCCCCCC T ss_conf 717654887536650100 No 5 >TIGR02036 dsdC D-serine deaminase transcriptional activator; InterPro: IPR011781 This family, part of the LysR family of transcriptional regulators, activates transcription of the gene for D-serine deaminase, dsdA. Trusted members of this family so far are found adjacent to dsdA and only in Gammaproteobacteria, including Escherichia coli, Vibrio cholerae, and Colwellia psychrerythraea.. Probab=19.07 E-value=46 Score=17.24 Aligned_cols=16 Identities=50% Similarity=0.970 Sum_probs=11.6 Q ss_pred EEEECCCEEECCCCCCCC Q ss_conf 489646132011100243 Q 537021.9.peg.1 8 WIYFGDEMIIPKKLECSS 25 (37) Q Consensus 8 wiyfgdemiipkklecss 25 (37) =|||.|.| |.||.|.. T Consensus 146 AIYFDd~~--p~kL~c~~ 161 (302) T TIGR02036 146 AIYFDDKQ--PAKLSCKE 161 (302) T ss_pred EEEECCCC--CCCCCHHH T ss_conf 88707888--74212012 No 6 >KOG2849 consensus Probab=16.66 E-value=58 Score=16.77 Aligned_cols=13 Identities=31% Similarity=0.557 Sum_probs=10.6 Q ss_pred CCCCCEEEECCCE Q ss_conf 3222048964613 Q 537021.9.peg.1 3 KKSLDWIYFGDEM 15 (37) Q Consensus 3 kksldwiyfgdem 15 (37) -+..|||||.+|- T Consensus 277 ~G~HnWvrfy~ee 289 (388) T KOG2849 277 DGFHNWVRFYDEE 289 (388) T ss_pred CCEEEEEEEEEEC T ss_conf 4402138874201 No 7 >cd06405 PB1_Mekk2_3 The PB1 domain is present in the two mitogen-activated protein kinase kinases MEKK2 and MEKK3 which are two members of the signaling kinase cascade involved in angiogenesis and early cardiovascular development. The PB1 domain of MEKK2 (and/or MEKK3) interacts with the PB1 domain of another member of the kinase cascade Map2k5. A canonical PB1-PB1 interaction, which involves heterodimerization of two PB1 domains, is required for the formation of macromolecular signaling complexes ensuring specificity and fidelity during cellular signaling. The interaction between two PB1 domain depends on the type of PB1. There are three types of PB1 domains: type I which contains an OPCA motif, acidic aminoacid cluster, type II which contains a basic cluster, and type I/II which contains both an OPCA motif and a basic cluster. Interactions of PB1 domains with other protein domains have been described as noncanonical PB1-interactions. The PB1 domain module is conserved in amoebas, f Probab=15.54 E-value=55 Score=16.87 Aligned_cols=25 Identities=28% Similarity=0.582 Sum_probs=18.8 Q ss_pred CCCCCEEEECCCEEECCCCCCCCCCCC Q ss_conf 322204896461320111002435660 Q 537021.9.peg.1 3 KKSLDWIYFGDEMIIPKKLECSSDLNH 29 (37) Q Consensus 3 kksldwiyfgdemiipkklecssdlnh 29 (37) ..++|-.|-..|++||- .|..||++ T Consensus 34 Gq~ldl~y~n~eL~IPl--~~Q~DLDk 58 (79) T cd06405 34 GQPMDLHYTNNELLIPL--KNQEDLDR 58 (79) T ss_pred CCEEEEEEECCEEEEEC--CCHHHHHH T ss_conf 98454577567378862--56777899 No 8 >pfam10383 Clr2 Transcription-silencing protein Clr2. Clr2 is a chromatin silencing protein, one of a quartet of proteins forming the core of SHREC, a multienzyme effector complex that mediates hetero-chromatic transcriptional gene silencing in fission yeast. Clr2 does not have any obvious well-conserved domains but, along with the other core proteins, binds to the histone deacetylase Clr3, and on its own might also have a role in chromatin organisation at the cnt domain, the site of kinetochore assembly. Probab=14.67 E-value=77 Score=16.15 Aligned_cols=11 Identities=27% Similarity=0.546 Sum_probs=8.4 Q ss_pred EEEECCCEEEC Q ss_conf 48964613201 Q 537021.9.peg.1 8 WIYFGDEMIIP 18 (37) Q Consensus 8 wiyfgdemiip 18 (37) =||+|-|||+- T Consensus 5 GIflGAE~l~v 15 (133) T pfam10383 5 GIFIGAELLWV 15 (133) T ss_pred CEEEEEEEEEE T ss_conf 58873067884 No 9 >TIGR02199 rfaE_dom_II rfaE bifunctional protein, domain II; InterPro: IPR011914 RfaE is a protein involved in the biosynthesis of ADP-L-glycero-D-manno-heptose, a precursor for LPS inner core biosynthesis. RfaE is a bifunctional protein in Escherichia coli, and separate proteins in some other genome. Domain I (IPR011913 from INTERPRO) is suggested to act in D-glycero-D-manno-heptose 1-phosphate biosynthesis, while domain II (this family) adds ADP to yield ADP-D-glycero-D-manno-heptose .; GO: 0016773 phosphotransferase activity alcohol group as acceptor, 0016779 nucleotidyltransferase activity, 0005975 carbohydrate metabolic process. Probab=14.39 E-value=21 Score=18.96 Aligned_cols=10 Identities=60% Similarity=0.916 Sum_probs=5.4 Q ss_pred CCEEEEEECC Q ss_conf 6024433229 Q 537021.9.peg.1 28 NHVSYLSLAK 37 (37) Q Consensus 28 nhvsylslak 37 (37) -||+||+-|| T Consensus 26 GHV~YL~~Ar 35 (144) T TIGR02199 26 GHVSYLQQAR 35 (144) T ss_pred CHHHHHHHHH T ss_conf 1376899999 No 10 >pfam06852 DUF1248 Protein of unknown function (DUF1248). This family represents a conserved region within a number of proteins of unknown function that seem to be specific to C. elegans. Note that some family members contain more than one copy of this region. Probab=13.35 E-value=66 Score=16.49 Aligned_cols=15 Identities=47% Similarity=0.682 Sum_probs=11.1 Q ss_pred EECCCEEECCCCCCC Q ss_conf 964613201110024 Q 537021.9.peg.1 10 YFGDEMIIPKKLECS 24 (37) Q Consensus 10 yfgdemiipkklecs 24 (37) |=.+||.||+.|+-+ T Consensus 144 Y~~~d~~iPedLd~~ 158 (180) T pfam06852 144 YEMDDMKIPEDLDLS 158 (180) T ss_pred CCHHCEECCCCCCCC T ss_conf 260000076535668 Done!