BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 537021.9.peg.1101_1 (37 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >537021.9.peg.1101_1 Length = 37 Score = 76.6 bits (187), Expect = 7e-17, Method: Compositional matrix adjust. Identities = 37/37 (100%), Positives = 37/37 (100%) Query: 1 VLKKSLDWIYFGDEMIIPKKLECSSDLNHVSYLSLAK 37 VLKKSLDWIYFGDEMIIPKKLECSSDLNHVSYLSLAK Sbjct: 1 VLKKSLDWIYFGDEMIIPKKLECSSDLNHVSYLSLAK 37 >gi|254781218|ref|YP_003065631.1| hypothetical protein CLIBASIA_05625 [Candidatus Liberibacter asiaticus str. psy62] Length = 205 Score = 39.3 bits (90), Expect = 1e-05, Method: Composition-based stats. Identities = 15/22 (68%), Positives = 19/22 (86%) Query: 1 VLKKSLDWIYFGDEMIIPKKLE 22 V KK LDWIYFGDE+I+PK ++ Sbjct: 164 VTKKHLDWIYFGDEVIVPKSIK 185 >537021.9.peg.1058_1 Length = 37 Score = 23.1 bits (48), Expect = 0.83, Method: Compositional matrix adjust. Identities = 9/11 (81%), Positives = 10/11 (90%) Query: 11 FGDEMIIPKKL 21 GDE+IIPKKL Sbjct: 5 LGDEVIIPKKL 15 >gi|254780168|ref|YP_003064581.1| monooxygenase FAD-binding protein [Candidatus Liberibacter asiaticus str. psy62] Length = 380 Score = 21.9 bits (45), Expect = 2.1, Method: Composition-based stats. Identities = 8/9 (88%), Positives = 8/9 (88%) Query: 2 LKKSLDWIY 10 L KSLDWIY Sbjct: 366 LHKSLDWIY 374 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.320 0.137 0.412 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 25,593 Number of Sequences: 1233 Number of extensions: 470 Number of successful extensions: 5 Number of sequences better than 100.0: 5 Number of HSP's better than 100.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of query: 37 length of database: 328,796 effective HSP length: 11 effective length of query: 26 effective length of database: 315,233 effective search space: 8196058 effective search space used: 8196058 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.3 bits) S2: 31 (16.5 bits)