RPS-BLAST 2.2.22 [Sep-27-2009] Database: pdb70 24,244 sequences; 5,693,230 total letters Searching..................................................done Query= 537021.9.peg.1140_1 (90 letters) >3nk6_A 23S rRNA methyltransferase; nosiheptide, nosiheptide-resistance methyltransferase, 23S R methyltransferase; 2.00A {Streptomyces actuosus} PDB: 3nk7_A* 3gyq_A* Length = 277 Score = 25.7 bits (56), Expect = 2.6 Identities = 5/38 (13%), Positives = 14/38 (36%), Gaps = 5/38 (13%) Query: 24 SKQDCLISQFKLFEKHYREQQK-----GVNEILDILKS 56 + D + + KH R K +++ +++ Sbjct: 12 NASDPAVQRIIDVTKHSRASIKTTLIEDTEPLMECIRA 49 >1un0_C Nucleoporin NUP2; nuclear import, armadillo repeat, NLS release, karyopherin recycling; 2.6A {Saccharomyces cerevisiae} PDB: 2c1t_C Length = 51 Score = 25.6 bits (56), Expect = 2.9 Identities = 7/15 (46%), Positives = 8/15 (53%) Query: 1 MTKRQEDHYITREEF 15 M KR D I RE + Sbjct: 1 MAKRVADAQIQRETY 15 >2jul_A Calsenilin; EF-hand, calcium, LXXLL, DNA binding protein, dimer, alternative splicing, apoptosis, cytoplasm, endoplasmic reticulum, golgi apparatus; NMR {Mus musculus} Length = 256 Score = 25.4 bits (55), Expect = 3.3 Identities = 10/31 (32%), Positives = 18/31 (58%), Gaps = 4/31 (12%) Query: 7 DHYITREEFIEFCTNSNSKQDCLISQFKLFE 37 D +T +EF+E C K + +++ +LFE Sbjct: 227 DGVVTIDEFLETC----QKDENIMNSMQLFE 253 >2ggz_A Guanylyl cyclase-activating protein 3; EF hand, guanylate cyclase activating protein, GCAP, GCAP3, GCAP-3, lyase activator; 3.00A {Homo sapiens} Length = 211 Score = 25.1 bits (54), Expect = 3.9 Identities = 11/51 (21%), Positives = 16/51 (31%), Gaps = 1/51 (1%) Query: 7 DHYITREEFIEFCTNSNSKQDCLISQFKLFEKHYREQQKGVNEILDILKSV 57 D +T EEFI + + F F R G ++ S Sbjct: 149 DGELTLEEFINGMAKDQDLLEIVYKSFD-FSNVLRVICNGKQPDMETDSSK 198 >1s1e_A KV channel interacting protein 1; kchip, calcium-binding protein, EF-finger, transport protein; 2.30A {Homo sapiens} SCOP: a.39.1.5 Length = 224 Score = 24.3 bits (52), Expect = 7.2 Identities = 9/32 (28%), Positives = 17/32 (53%), Gaps = 4/32 (12%) Query: 7 DHYITREEFIEFCTNSNSKQDCLISQFKLFEK 38 D +T +EF+E C + D ++ +LF+ Sbjct: 187 DGIVTLDEFLESC----QEDDNIMRSLQLFQN 214 >1nxc_A Mannosyl-oligosaccharide 1,2-alpha-mannosidase IA; glycosidase, structural genomics, PSI, protein structure initiative; HET: NAG BMA MAN; 1.51A {Mus musculus} SCOP: a.102.2.1 Length = 478 Score = 23.8 bits (51), Expect = 8.5 Identities = 12/47 (25%), Positives = 18/47 (38%), Gaps = 6/47 (12%) Query: 1 MTKRQEDHYITREEFIEFC------TNSNSKQDCLISQFKLFEKHYR 41 T++ E +YI R E IE T+ + + E H R Sbjct: 359 ATRQNEKYYILRPEVIETYMYMWRLTHDPKYRTWAWEAVEALESHCR 405 >1nxi_A Conserved hypothetical protein VC0424; structural genomics, AB sandwich, COG 3076, ATCC NO. 51394D, NESG target OP3, PSI; NMR {Vibrio cholerae} SCOP: d.58.47.1 Length = 132 Score = 24.0 bits (52), Expect = 9.4 Identities = 6/21 (28%), Positives = 9/21 (42%) Query: 5 QEDHYITREEFIEFCTNSNSK 25 +D Y++ EE IE Sbjct: 3 HQDDYLSVEELIEIQKEETRD 23 Database: pdb70 Posted date: Jan 26, 2011 11:21 AM Number of letters in database: 5,693,230 Number of sequences in database: 24,244 Lambda K H 0.323 0.136 0.400 Gapped Lambda K H 0.267 0.0564 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 24244 Number of Hits to DB: 737,814 Number of extensions: 26732 Number of successful extensions: 113 Number of sequences better than 10.0: 1 Number of HSP's gapped: 112 Number of HSP's successfully gapped: 28 Length of query: 90 Length of database: 5,693,230 Length adjustment: 57 Effective length of query: 33 Effective length of database: 4,311,322 Effective search space: 142273626 Effective search space used: 142273626 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (22.0 bits) S2: 50 (23.4 bits)