Query 537021.9.peg.128_1 Match_columns 42 No_of_seqs 1 out of 3 Neff 1.0 Searched_HMMs 39220 Date Tue May 24 00:02:33 2011 Command /home/congqian_1/programs/hhpred/hhsearch -i peg_128.hhm -d /home/congqian_1/database/cdd/Cdd.hhm No Hit Prob E-value P-value Score SS Cols Query HMM Template HMM 1 pfam12202 OSR1_C Oxidative-str 20.3 48 0.0012 16.8 1.1 11 17-27 20-30 (38) 2 KOG4697 consensus 19.3 34 0.00088 17.5 0.2 18 15-39 111-128 (160) 3 pfam05373 Pro_3_hydrox_C L-pro 16.8 95 0.0024 15.3 2.0 32 7-40 46-77 (101) 4 COG3739 Uncharacterized integr 16.4 27 0.00068 18.0 -0.9 22 15-36 189-210 (263) 5 pfam07069 PRRSV_2b Porcine rep 14.8 41 0.001 17.1 -0.3 20 19-41 34-53 (73) 6 TIGR01524 ATPase-IIIB_Mg magne 14.0 87 0.0022 15.5 1.2 12 27-38 861-872 (892) 7 COG5558 Transposase [DNA repli 11.4 1.7E+02 0.0043 14.0 2.0 31 8-38 163-200 (261) 8 TIGR00935 2a45 arsenical pump 11.0 1.4E+02 0.0035 14.5 1.5 17 24-40 71-87 (507) 9 pfam09451 ATG27 Autophagy-rela 10.9 1.2E+02 0.0029 14.9 1.0 10 28-37 198-207 (265) 10 TIGR02311 HpaI 2,4-dihydroxyhe 10.3 48 0.0012 16.7 -1.1 5 30-34 34-38 (249) No 1 >pfam12202 OSR1_C Oxidative-stress-responsive kinase 1 C terminal. This domain family is found in eukaryotes, and is approximately 40 amino acids in length. The family is found in association with pfam00069. There is a single completely conserved residue F that may be functionally important. OSR1 is involved in the signalling cascade which activates Na/K/2Cl cotransporter during osmotic stress. This domain is the C terminal domain of OSR1 which recognizes a motif (Arg-Phe-Xaa-Val) on the OSR1-activating protein WNK1. Probab=20.33 E-value=48 Score=16.76 Aligned_cols=11 Identities=36% Similarity=0.634 Sum_probs=8.0 Q ss_pred CCCEEEEEEHH Q ss_conf 03237885013 Q 537021.9.peg.1 17 SFPIQFSFDCA 27 (42) Q Consensus 17 sfpiqfsfdca 27 (42) .-.|||+||-. T Consensus 20 neaIqF~Fdl~ 30 (38) T pfam12202 20 NEAIEFEFDLG 30 (38) T ss_pred CCCEEEEEECC T ss_conf 86379999747 No 2 >KOG4697 consensus Probab=19.28 E-value=34 Score=17.47 Aligned_cols=18 Identities=44% Similarity=1.010 Sum_probs=10.9 Q ss_pred HCCCCEEEEEEHHHHHHHHHHHHHH Q ss_conf 0003237885013589999999998 Q 537021.9.peg.1 15 LRSFPIQFSFDCAGYFDWLLVILKR 39 (42) Q Consensus 15 lrsfpiqfsfdcagyfdwllvilkr 39 (42) -|+||-|||. |+|-++.. T Consensus 111 nr~fPsqfsW-------w~LqVis~ 128 (160) T KOG4697 111 NRKFPSQFSW-------WFLQVISS 128 (160) T ss_pred CCCCCCHHHH-------HHHHHHHH T ss_conf 3568750179-------99999988 No 3 >pfam05373 Pro_3_hydrox_C L-proline 3-hydroxylase, C-terminal. Iron (II)/2-oxoglutarate (2-OG)-dependent oxygenases catalyse oxidative reactions in a range of metabolic processes. Proline 3-hydroxylase hydroxylates proline at position 3, the first of a 2-OG oxygenase catalysing oxidation of a free alpha-amino acid. The structure contains conserved motifs present in other 2-OG oxygenases including a jelly roll strand core and residues binding iron and 2-oxoglutarate, consistent with divergent evolution within the extended family. The structure differs significantly from many other 2-OG oxygenases in possessing a discrete C-terminal helical domain. Probab=16.81 E-value=95 Score=15.30 Aligned_cols=32 Identities=31% Similarity=0.718 Sum_probs=20.4 Q ss_pred EEEEEHHHHCCCCEEEEEEHHHHHHHHHHHHHHH Q ss_conf 3000001000032378850135899999999986 Q 537021.9.peg.1 7 KDVAFKTSLRSFPIQFSFDCAGYFDWLLVILKRL 40 (42) Q Consensus 7 kdvafktslrsfpiqfsfdcagyfdwllvilkrl 40 (42) +|+.|--|- +-......|..-+|||.-|-||- T Consensus 46 RDIvf~LsK--~Hf~~~v~~~~~ydWL~ei~kr~ 77 (101) T pfam05373 46 RDIVFILSK--LHFTYKVHCREMYDWLIEICKRR 77 (101) T ss_pred HHHHHHHHH--HHHHEECCHHHHHHHHHHHHHHC T ss_conf 999999988--75210068799999999999872 No 4 >COG3739 Uncharacterized integral membrane protein [Function unknown] Probab=16.38 E-value=27 Score=18.03 Aligned_cols=22 Identities=41% Similarity=0.791 Sum_probs=18.0 Q ss_pred HCCCCEEEEEEHHHHHHHHHHH Q ss_conf 0003237885013589999999 Q 537021.9.peg.1 15 LRSFPIQFSFDCAGYFDWLLVI 36 (42) Q Consensus 15 lrsfpiqfsfdcagyfdwllvi 36 (42) -|+.|+-|||-|-|.|-|+--- T Consensus 189 ~~kMPl~~sfvlIgfFIw~AEN 210 (263) T COG3739 189 ARKMPLLFSFVLIGFFIWLAEN 210 (263) T ss_pred CCCCCHHHHHHHHHHHHHHHHH T ss_conf 2025568999999999999988 No 5 >pfam07069 PRRSV_2b Porcine reproductive and respiratory syndrome virus 2b. This family consists of several Porcine reproductive and respiratory syndrome virus (PRRSV) ORF2b proteins. The function of this family is unknown however it is known that large amounts of 2b protein are present in the virion and it is thought that this protein may be an integral component of the virion. Probab=14.80 E-value=41 Score=17.09 Aligned_cols=20 Identities=50% Similarity=0.931 Sum_probs=14.8 Q ss_pred CEEEEEEHHHHHHHHHHHHHHHC Q ss_conf 23788501358999999999861 Q 537021.9.peg.1 19 PIQFSFDCAGYFDWLLVILKRLV 41 (42) Q Consensus 19 piqfsfdcagyfdwllvilkrlv 41 (42) .|-|.|.-|| ||+|.+-|+| T Consensus 34 ail~gftiag---wl~vf~ir~v 53 (73) T pfam07069 34 AILFGFTIAG---WLVVFCIKLV 53 (73) T ss_pred HHHHHHHHHH---HHHHHHHHHH T ss_conf 9999668999---9999999999 No 6 >TIGR01524 ATPase-IIIB_Mg magnesium-translocating P-type ATPase; InterPro: IPR006415 This group describes the magnesium translocating P-type ATPase found in a limited number of bacterial species and best described in Salmonella typhimurium, which contains two isoforms . These transporters are active in low external Mg2+ concentrations and pump the ion into the cytoplasm. The magnesium ATPases have been classified as type IIIB by a phylogenetic analysis .; GO: 0015444 magnesium-importing ATPase activity, 0015693 magnesium ion transport, 0016021 integral to membrane. Probab=13.97 E-value=87 Score=15.47 Aligned_cols=12 Identities=50% Similarity=1.129 Sum_probs=9.8 Q ss_pred HHHHHHHHHHHH Q ss_conf 358999999999 Q 537021.9.peg.1 27 AGYFDWLLVILK 38 (42) Q Consensus 27 agyfdwllvilk 38 (42) ..||-||..||- T Consensus 861 lSYFPWLiaiLv 872 (892) T TIGR01524 861 LSYFPWLIAILV 872 (892) T ss_pred CCHHHHHHHHHH T ss_conf 750079999999 No 7 >COG5558 Transposase [DNA replication, recombination, and repair] Probab=11.37 E-value=1.7e+02 Score=14.04 Aligned_cols=31 Identities=32% Similarity=0.489 Sum_probs=22.6 Q ss_pred EEEEHHHHCCCCEEEEEE-------HHHHHHHHHHHHH Q ss_conf 000001000032378850-------1358999999999 Q 537021.9.peg.1 8 DVAFKTSLRSFPIQFSFD-------CAGYFDWLLVILK 38 (42) Q Consensus 8 dvafktslrsfpiqfsfd-------cagyfdwllvilk 38 (42) |--+++.||-||-.-+.- ..|-|||+-+|+. T Consensus 163 dKYY~sTL~~F~~~~~~~v~~~~~~~r~G~~W~~~I~R 200 (261) T COG5558 163 DKYYSSTLRLFDAETAVYVIPKRNLARIGFDWLRVIER 200 (261) T ss_pred HHHHHHHHHCCCCCEEEEECCCCCHHHHHHHHHHHHHH T ss_conf 56676577527864069964765344402569999999 No 8 >TIGR00935 2a45 arsenical pump membrane protein; InterPro: IPR000802 Arsenic is a toxic metalloid whose trivalent and pentavalent ions inhibit a variety of biochemical processes. Operons that encode arsenic resistance have been found in multicopy plasmids from both Gram-positive and Gram-negative bacteria . The resistance mechanism is encoded from a single operon, which houses an anion pump. The pump has two polypeptide components: a catalytic subunit (the ArsA protein), which functions as an oxyanion-stimulated ATPase; and an arsenite export component (the ArsB protein), which is associated with the inner membrane . The ArsA and ArsB proteins are thought to form a membrane complex that functions as an anion-translocating ATPase. The ArsB protein is distinguished by its overall hydrophobic character, in keeping with its role as a membrane-associated channel. Sequence analysis reveals the presence of 13 putative transmembrane (TM) regions.; GO: 0015105 arsenite transmembrane transporter activity, 0016021 integral to membrane. Probab=10.97 E-value=1.4e+02 Score=14.46 Aligned_cols=17 Identities=41% Similarity=0.923 Sum_probs=0.0 Q ss_pred EEHHHHHHHHHHHHHHH Q ss_conf 50135899999999986 Q 537021.9.peg.1 24 FDCAGYFDWLLVILKRL 40 (42) Q Consensus 24 fdcagyfdwllvilkrl 40 (42) +|-.|+|||.-+-.-|+ T Consensus 71 LdE~GfFew~A~~~~r~ 87 (507) T TIGR00935 71 LDETGFFEWAAVHVYRL 87 (507) T ss_pred HHHCCHHHHHHHHHHHH T ss_conf 71034678999999984 No 9 >pfam09451 ATG27 Autophagy-related protein 27. Probab=10.93 E-value=1.2e+02 Score=14.86 Aligned_cols=10 Identities=50% Similarity=1.474 Sum_probs=0.0 Q ss_pred HHHHHHHHHH Q ss_conf 5899999999 Q 537021.9.peg.1 28 GYFDWLLVIL 37 (42) Q Consensus 28 gyfdwllvil 37 (42) |+|-|+.+|+ T Consensus 198 G~FTWlfi~~ 207 (265) T pfam09451 198 GWFTWLFIYL 207 (265) T ss_pred CHHHHHHHHH T ss_conf 5035687999 No 10 >TIGR02311 HpaI 2,4-dihydroxyhept-2-ene-1,7-dioic acid aldolase; InterPro: IPR012689 This entry represents the aldolase which performs the final step unique to the 4-hydroxyphenylacetic acid catabolism pathway in which 2,4-dihydroxyhept-2-ene-1,7-dioic acid is split into pyruvate and succinate-semialdehyde. The gene for enzyme is generally found adjacent to other genes for this pathway.; GO: 0018802 24-dihydroxyhept-2-ene-17-dioate aldolase activity, 0010124 phenylacetate catabolic process. Probab=10.32 E-value=48 Score=16.74 Aligned_cols=5 Identities=100% Similarity=2.255 Sum_probs=0.0 Q ss_pred HHHHH Q ss_conf 99999 Q 537021.9.peg.1 30 FDWLL 34 (42) Q Consensus 30 fdwll 34 (42) ||||| T Consensus 34 fDWLL 38 (249) T TIGR02311 34 FDWLL 38 (249) T ss_pred CCEEE T ss_conf 63110 Done!