BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 537021.9.peg.233_1 (72 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >537021.9.peg.233_1 Length = 72 Score = 139 bits (350), Expect = 9e-36, Method: Compositional matrix adjust. Identities = 72/72 (100%), Positives = 72/72 (100%) Query: 1 MISKNNPRTPPKAHPNILSSNTERIRIGVLIIFNKIDTTVNIIKNNGIIVIIIATCLLLK 60 MISKNNPRTPPKAHPNILSSNTERIRIGVLIIFNKIDTTVNIIKNNGIIVIIIATCLLLK Sbjct: 1 MISKNNPRTPPKAHPNILSSNTERIRIGVLIIFNKIDTTVNIIKNNGIIVIIIATCLLLK 60 Query: 61 NSDTLSKSIGYR 72 NSDTLSKSIGYR Sbjct: 61 NSDTLSKSIGYR 72 >gi|254780174|ref|YP_003064587.1| putative oxidoreductase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 78 Score = 24.3 bits (51), Expect = 0.38, Method: Compositional matrix adjust. Identities = 10/48 (20%), Positives = 22/48 (45%) Query: 9 TPPKAHPNILSSNTERIRIGVLIIFNKIDTTVNIIKNNGIIVIIIATC 56 TPP P + ++++ V + F ++ ++GI +I +C Sbjct: 8 TPPYIEPLLGYTSSKDTLQQVKLFFPSLEAAEKYASDHGIQYCVIPSC 55 >gi|254780694|ref|YP_003065107.1| probable transcriptional regulator protein, LuxR family [Candidatus Liberibacter asiaticus str. psy62] Length = 246 Score = 24.3 bits (51), Expect = 0.41, Method: Composition-based stats. Identities = 12/30 (40%), Positives = 18/30 (60%), Gaps = 3/30 (10%) Query: 9 TPPKAHPN---ILSSNTERIRIGVLIIFNK 35 TPP N L+ + RIRIG++++F K Sbjct: 121 TPPAGMDNRYCSLTFDVARIRIGLMLLFPK 150 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.320 0.138 0.384 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 47,656 Number of Sequences: 1233 Number of extensions: 1614 Number of successful extensions: 4 Number of sequences better than 100.0: 4 Number of HSP's better than 100.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of query: 72 length of database: 328,796 effective HSP length: 42 effective length of query: 30 effective length of database: 277,010 effective search space: 8310300 effective search space used: 8310300 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.3 bits) S2: 31 (16.5 bits)