BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 537021.9.peg.254_1
         (38 letters)

Database: las_proteome 
           1233 sequences; 328,796 total letters

Searching...................................................done



>537021.9.peg.254_1 
          Length = 38

 Score = 79.3 bits (194), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 38/38 (100%), Positives = 38/38 (100%)

Query: 1  VPCYFYGGYFHNENGYEKKGIKFLISKSRIRCVQFGIN 38
          VPCYFYGGYFHNENGYEKKGIKFLISKSRIRCVQFGIN
Sbjct: 1  VPCYFYGGYFHNENGYEKKGIKFLISKSRIRCVQFGIN 38


>gi|254780700|ref|YP_003065113.1| serine protease DO-like protease [Candidatus Liberibacter asiaticus
           str. psy62]
          Length = 489

 Score = 21.2 bits (43), Expect = 3.2,   Method: Composition-based stats.
 Identities = 11/20 (55%), Positives = 12/20 (60%)

Query: 18  KKGIKFLISKSRIRCVQFGI 37
           KK I  LISK R+    FGI
Sbjct: 268 KKAIPSLISKGRVDHGWFGI 287


>gi|254780628|ref|YP_003065041.1| coproporphyrinogen III oxidase [Candidatus Liberibacter asiaticus
           str. psy62]
          Length = 395

 Score = 20.8 bits (42), Expect = 4.3,   Method: Composition-based stats.
 Identities = 8/25 (32%), Positives = 14/25 (56%)

Query: 13  ENGYEKKGIKFLISKSRIRCVQFGI 37
           E   +++G    +  SR+RC Q G+
Sbjct: 359 ERNLQRQGFIERVQFSRLRCTQRGM 383


  Database: las_proteome
    Posted date:  Jun 5, 2011  6:30 PM
  Number of letters in database: 328,796
  Number of sequences in database:  1233
  
Lambda     K      H
   0.328    0.150    0.496 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 28,869
Number of Sequences: 1233
Number of extensions: 612
Number of successful extensions: 3
Number of sequences better than 100.0: 3
Number of HSP's better than 100.0 without gapping: 3
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3
length of query: 38
length of database: 328,796
effective HSP length: 12
effective length of query: 26
effective length of database: 314,000
effective search space:  8164000
effective search space used:  8164000
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 31 (16.5 bits)