HHsearch alignment for GI: peg_33 and conserved domain: COG4747

>COG4747 ACT domain-containing protein [General function prediction only].
Probab=94.93  E-value=0.26  Score=27.79  Aligned_cols=63  Identities=21%  Similarity=0.182  Sum_probs=43.2

Q ss_pred             EEEEECCCCCHHHHHHHHHHHCCCCEEEEEEECCCCCCEEEEEEEECCCCCHHHHHHHHCCCCEEEE
Q ss_conf             9999828786688999899736996322774214789818999994788998999998649882999
Q 537021.9.peg.3   26 ICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAISFLCIDGSILNSVLEKLSVNVTIRFV   92 (100)
Q Consensus        26 L~i~~~D~PG~I~~v~~~L~~~~INIa~m~l~r~~~g~~A~~ii~vD~~i~~~vl~~i~~~~~v~~v   92 (100)
T Consensus         6 ISvFlENk~GRL~~~~~~L~eagINiRA~tiAd--t~dFGIiRmvV--~~~d~A~~~Lee~gF~Vr~   68 (142)
T COG4747           6 ISVFLENKPGRLASVANKLKEAGINIRAFTIAD--TGDFGIIRMVV--DRPDEAHSVLEEAGFTVRE   68 (142)
T ss_pred             EEEEECCCCCHHHHHHHHHHHCCCCEEEEEECC--CCCCCEEEEEC--CCHHHHHHHHHHCCCEEEE
T ss_conf             998750786449999999997698658887303--66753699970--8858999999877938986