HHsearch alignment for GI: peg_33 and conserved domain: KOG2663

>KOG2663 consensus.
Probab=96.94  E-value=0.0012  Score=40.18  Aligned_cols=74  Identities=14%  Similarity=0.163  Sum_probs=53.7

Q ss_pred             ECCCCEEEEEECCCCCHHHHHHHHHHHCCCCEEEEEEECCCCCCEEEE--EEEECCCCCHHHHHHHHCCCCEEEEE
Q ss_conf             579839999982878668899989973699632277421478981899--99947889989999986498829999
Q 537021.9.peg.3   20 DIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS--FLCIDGSILNSVLEKLSVNVTIRFVK   93 (100)
Q Consensus        20 ~~~~~~L~i~~~D~PG~I~~v~~~L~~~~INIa~m~l~r~~~g~~A~~--ii~vD~~i~~~vl~~i~~~~~v~~vr   93 (100)
T Consensus        74 r~krHvinclVqnEpGvlsRisGvlAaRGfNIdSLvVc~tevk~LsrmTIVl~Gtd~VveQa~rQiedlVnV~aVl  149 (309)
T KOG2663          74 RVKRHVINCLVQNEPGVLSRISGVLAARGFNIDSLVVCLTEVKALSRMTIVLQGTDGVVEQARRQIEDLVNVYAVL  149 (309)
T ss_pred             CCCCEEEEEEECCCCHHHHHHHHHHHHCCCCCHHEEEECHHHHHHHHCEEEEECCHHHHHHHHHHHHHHHHHHEEE
T ss_conf             3400158888317822888888888761577213133004445444415889554789999999999764420231