HHsearch alignment for GI: peg_33 and conserved domain: PRK10820

>PRK10820 DNA-binding transcriptional regulator TyrR; Provisional.
Probab=97.84  E-value=6.7e-05  Score=46.72  Aligned_cols=71  Identities=11%  Similarity=0.157  Sum_probs=62.0

Q ss_pred             EEEEEECCCCCHHHHHHHHHHHCCCCEEEEEEECCCCCCEEEEEEEECCCCCHHHHHHHHCCCCEEEEEEEEE
Q ss_conf             9999982878668899989973699632277421478981899999478899899999864988299999997
Q 537021.9.peg.3   25 MICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF   97 (100)
Q Consensus        25 ~L~i~~~D~PG~I~~v~~~L~~~~INIa~m~l~r~~~g~~A~~ii~vD~~i~~~vl~~i~~~~~v~~vr~i~~   97 (100)
T Consensus         2 rlei~c~DRvGi~~dil~~l~~~~idl~~iEv~--~~~~iyl~~~~~~~~~~~~l~~~ir~i~gv~~v~~v~~   72 (513)
T PRK10820          2 RLEVFCEDRLGLTRELLDLLVLRSIDLRGIEID--PIGRIYLNFAELEFESFSSLMAEIRRIAGVTDVRTVPW   72 (513)
T ss_pred             EEEEEECCCCCHHHHHHHHHHHCCCCEEEEEEC--CCCEEEEECCCCCHHHHHHHHHHHHCCCCCCEEEEEEC
T ss_conf             269995155635999999999769883699972--68838997786687889999999854898543677604