HHsearch alignment for GI: peg_33 and conserved domain: PRK13562

>PRK13562 acetolactate synthase 1 regulatory subunit; Provisional.
Probab=97.50  E-value=0.00062  Score=41.63  Aligned_cols=74  Identities=15%  Similarity=0.221  Sum_probs=59.9

Q ss_pred             CCEEEEEECCCCCHHHHHHHHHHHCCCCEEEEEEECCCCCCEEEEEEEEC---CCCCHHHHHHHHCCCCEEEEEEEE
Q ss_conf             83999998287866889998997369963227742147898189999947---889989999986498829999999
Q 537021.9.peg.3   23 RLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAISFLCID---GSILNSVLEKLSVNVTIRFVKQFE   96 (100)
Q Consensus        23 ~~~L~i~~~D~PG~I~~v~~~L~~~~INIa~m~l~r~~~g~~A~~ii~vD---~~i~~~vl~~i~~~~~v~~vr~i~   96 (100)
T Consensus         2 krtl~~~V~dq~gvLNRIT~lF~RrqfNI~sltVg~te~~gIS~mt~vv~v~d~~~~eqlikqL~KqInVL~V~~~~   78 (84)
T PRK13562          2 TRILKLQVADQVSTLNRITSAFVRLQYNIDTLHVTHSEQPGISNMEIQVDIQDDTSLHILIKKLKQQINVLTVECYD   78 (84)
T ss_pred             CEEEEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCCCCCCCCCEEEEEECCCHHHHHHHHHHHHHHEEEEEEEEEE
T ss_conf             61899999547508889899999851782268863678988342699996486789999999998545579899983