HHsearch alignment for GI: peg_33 and conserved domain: PRK13581

>PRK13581 D-3-phosphoglycerate dehydrogenase; Provisional.
Probab=100.00  E-value=1.9e-34  Score=202.45  Aligned_cols=97  Identities=36%  Similarity=0.574  Sum_probs=95.2

Q ss_pred             CCCCCEEEEEEECCEEEEEECCCCEEEEEECCCCCHHHHHHHHHHHCCCCEEEEEEECCCCCCEEEEEEEECCCCCHHHH
Q ss_conf             95587378999799899765798399999828786688999899736996322774214789818999994788998999
Q 537021.9.peg.3    1 VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAISFLCIDGSILNSVL   80 (100)
Q Consensus         1 vfg~g~~riv~i~g~~v~~~~~~~~L~i~~~D~PG~I~~v~~~L~~~~INIa~m~l~r~~~g~~A~~ii~vD~~i~~~vl   80 (100)
T Consensus       428 vf~~~~pRIV~I~g~~vd~~p~G~mL~~~n~D~PGvIG~VGtiLG~~~INIA~m~lgR~~~gg~Ai~vl~vD~~v~~evl  507 (524)
T PRK13581        428 VFGDGEPRIVEINGFRVDAKPEGHMLVIRNRDRPGVIGKIGTLLGEHGINIASMQLGRDEAGGEALMVLSVDDPVPDEVL  507 (524)
T ss_pred             EECCCEEEEEEECCEEEEEECCCCEEEEEECCCCCHHHHHHHHHHHCCCCCHHCEECCCCCCCEEEEEEECCCCCCHHHH
T ss_conf             93599068999999999985467689997078697143988888656989233574578899747999987999999999


Q ss_pred             HHHHCCCCEEEEEEEEE
Q ss_conf             99864988299999997
Q 537021.9.peg.3   81 EKLSVNVTIRFVKQFEF   97 (100)
Q Consensus        81 ~~i~~~~~v~~vr~i~~   97 (100)
T Consensus       508 ~~l~~~~~I~~v~~v~l  524 (524)
T PRK13581        508 EELKALPGILSAKAVEL  524 (524)
T ss_pred             HHHHCCCCCEEEEEEEC
T ss_conf             99866888428999759