HHsearch alignment for GI: peg_33 and conserved domain: cd04869

>cd04869 ACT_GcvR_2 ACT domains that comprise the Glycine Cleavage System Transcriptional Repressor (GcvR) protein, and other related domains. This CD includes the second of the two ACT domains that comprise the Glycine Cleavage System Transcriptional Repressor (GcvR) protein, and other related domains. The glycine cleavage enzyme system in Escherichia coli provides one-carbon units for cellular methylation reactions. This enzyme system, encoded by the gcvTHP operon and lpd gene, catalyzes the cleavage of glycine into CO2 + NH3 and transfers a one-carbon unit to tetrahydrofolate, producing 5,10-methylenetetrahydrofolate. The gcvTHP operon is activated by the GcvA protein in response to glycine and repressed by a GcvA/GcvR interaction in the absence of glycine. It has been proposed that the co-activator glycine acts through a mechanism of de-repression by binding to GcvR and preventing GcvR from interacting with GcvA to block GcvA's activator function. Evidence also suggests that GcvR in
Probab=97.51  E-value=0.00021  Score=44.12  Aligned_cols=61  Identities=23%  Similarity=0.244  Sum_probs=39.6

Q ss_pred             EEEEECCCCCHHHHHHHHHHHCCCCEEEEEEECCCC--CCE----EEEEEEECCCCC-HHHHHHHHCC
Q ss_conf             999982878668899989973699632277421478--981----899999478899-8999998649
Q 537021.9.peg.3   26 ICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQS--TEH----AISFLCIDGSIL-NSVLEKLSVN   86 (100)
Q Consensus        26 L~i~~~D~PG~I~~v~~~L~~~~INIa~m~l~r~~~--g~~----A~~ii~vD~~i~-~~vl~~i~~~   86 (100)
T Consensus         2 ~~v~G~DrpGIv~~it~~La~~~inI~~l~t~~~~a~~sg~~lF~a~~~v~lP~~~~~~~L~~~l~~l   69 (81)
T cd04869           2 VEVVGNDRPGIVHEVTQFLAQRNINIEDLSTETYSAPMSGTPLFKAQATLALPAGTDLDALREELEEL   69 (81)
T ss_pred             EEEEECCCCCHHHHHHHHHHHCCCCCEEEEEEEECCCCCCCCCEEEEEEEECCCCCCHHHHHHHHHHH
T ss_conf             89980899887999999999869981466877763999981036899999379999999999999999