HHsearch alignment for GI: peg_33 and conserved domain: cd04880

>cd04880 ACT_AAAH-PDT-like ACT domain of the nonheme iron-dependent, aromatic amino acid hydroxylases (AAAH). ACT domain of the nonheme iron-dependent, aromatic amino acid hydroxylases (AAAH): Phenylalanine hydroxylases (PAH), tyrosine hydroxylases (TH) and tryptophan hydroxylases (TPH), both peripheral (TPH1) and neuronal (TPH2) enzymes. This family of enzymes shares a common catalytic mechanism, in which dioxygen is used by an active site containing a single, reduced iron atom to hydroxylate an unactivated aromatic substrate, concomitant with a two-electron oxidation of tetrahydropterin (BH4) cofactor to its quinonoid dihydropterin form. Eukaryotic AAAHs have an N-terminal ACT (regulatory) domain, a middle catalytic domain and a C-terminal domain which is responsible for the oligomeric state of the enzyme forming a domain-swapped tetrameric coiled-coil. The PAH, TH, and TPH enzymes contain highly conserved catalytic domains but distinct N-terminal ACT domains and differ in their mech
Probab=96.60  E-value=0.024  Score=33.27  Aligned_cols=60  Identities=20%  Similarity=0.237  Sum_probs=45.1

Q ss_pred             EEEEECCCCCHHHHHHHHHHHCCCCEEEEEEECCCCC--CEEEEEEEECCCCC----HHHHHHHHCC
Q ss_conf             9999828786688999899736996322774214789--81899999478899----8999998649
Q 537021.9.peg.3   26 ICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST--EHAISFLCIDGSIL----NSVLEKLSVN   86 (100)
Q Consensus        26 L~i~~~D~PG~I~~v~~~L~~~~INIa~m~l~r~~~g--~~A~~ii~vD~~i~----~~vl~~i~~~   86 (100)
T Consensus         2 i~f~~~~~pGaL~~~L~~F~~~~iNlt~IeS-RP~~~~~~~y~F~id~eg~~~~~~~~~~l~~l~~~   67 (75)
T cd04880           2 LVFSLKNKPGALAKALKVFAERGINLTKIES-RPSRKGLWEYEFFVDFEGHIDDPDVKEALEELKRV   67 (75)
T ss_pred             EEEEECCCCCHHHHHHHHHHHCCCCEEEEEE-EECCCCCCEEEEEEEEECCCCCHHHHHHHHHHHHH
T ss_conf             8999689787899999999988966799995-77499995699999971685978999999999984