HHsearch alignment for GI: peg_33 and conserved domain: cd04882

>cd04882 ACT_Bt0572_2 C-terminal ACT domain of a novel protein composed of just two ACT domains. Included in this CD is the C-terminal ACT domain of a novel protein composed of just two ACT domains, as seen in the yet uncharacterized structure (pdb 2F06) of the Bt0572 protein from Bacteroides thetaiotaomicron and related proteins. Members of this CD belong to the superfamily of ACT regulatory domains.
Probab=98.39  E-value=1.7e-06  Score=55.08  Aligned_cols=58  Identities=21%  Similarity=0.199  Sum_probs=50.6

Q ss_pred             EEEEECCCCCHHHHHHHHHHHCCCCEEEEEEECCCCCCEEEEEEEECCCCCHHHHHHHHC
Q ss_conf             999982878668899989973699632277421478981899999478899899999864
Q 537021.9.peg.3   26 ICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAISFLCIDGSILNSVLEKLSV   85 (100)
Q Consensus        26 L~i~~~D~PG~I~~v~~~L~~~~INIa~m~l~r~~~g~~A~~ii~vD~~i~~~vl~~i~~   85 (100)
T Consensus         2 iaVev~D~pGgL~~il~~L~~~~INIeY~Yaf~~~~~~~a~lI~r~~d--~e~a~~~L~~   59 (65)
T cd04882           2 LAVEVPDKPGGLHEILQILSEEGINIEYMYAFVEKKGGKALLIFRTED--IEKAIEVLQE   59 (65)
T ss_pred             EEEEECCCCCHHHHHHHHHHHCCCCEEEEEEEECCCCCEEEEEEEECC--HHHHHHHHHH
T ss_conf             899947988719999999988798879999994378976899998199--9999999998