HHsearch alignment for GI: peg_33 and conserved domain: cd04884

>cd04884 ACT_CBS C-terminal ACT domain of the cystathionine beta-synthase (CBS) domain protein found in Thermotoga maritima, Tm0935, and delta proteobacteria. This CD includes the C-terminal ACT domain of the cystathionine beta-synthase (CBS) domain protein found in Thermotoga maritima, Tm0935, and delta proteobacteria. This protein has two N-terminal tandem CBS domains and a single C-terminal ACT domain. The CBS domain is found in a wide range of proteins, often in tandem arrangements and together with a variety of other functional domains. It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown. Members of this CD belong to the superfamily of ACT regulatory domains.
Probab=92.30  E-value=0.6  Score=25.86  Aligned_cols=62  Identities=21%  Similarity=0.244  Sum_probs=43.7

Q ss_pred             EEECCCCCHHHHHHHHHHHCCCCEEEEEEECCC-CCCEEEEEEEE---CCCCCHHHHHHHHCCCCE
Q ss_conf             998287866889998997369963227742147-89818999994---788998999998649882
Q 537021.9.peg.3   28 IVNADILGIVVFVGNILGEYGINIAHFHLGRSQ-STEHAISFLCI---DGSILNSVLEKLSVNVTI   89 (100)
Q Consensus        28 i~~~D~PG~I~~v~~~L~~~~INIa~m~l~r~~-~g~~A~~ii~v---D~~i~~~vl~~i~~~~~v   89 (100)
T Consensus         4 f~L~d~pGslk~v~D~Lr~~~~rI~SILTs~~~~~~g~R~V~IRi~~mD~a~l~~l~e~L~~~~~l   69 (72)
T cd04884           4 FLLEDKPGTLKPVVDTLREFNARIISILTAFEDAPDGMRRVFIRVTPMDRSKENELIEELKAKFTV   69 (72)
T ss_pred             EECCCCCCCHHHHHHHHHHCCCEEEEEEECCCCCCCCCEEEEEEECCCCHHHHHHHHHHHHHHCCE
T ss_conf             886899985279999998779859999833676899822899996356577799999999854557