>cd04925 ACT_ACR_2 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein). This CD includes the second ACT domain, of a novel type of ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein). ACR proteins, found only in Arabidopsis and Oryza, as yet, are proposed to function as novel regulatory or sensor proteins in plants. Nine ACR gene products have been described (ACR1-8 in Arabidopsis and OsARC1-9 in Oryza) and are represented in this CD. Members of this CD belong to the superfamily of ACT regulatory domains.

Probab=96.18 E-value=0.039 Score=32.12 Aligned_cols=59 Identities=17% Similarity=0.118 Sum_probs=41.4 Q ss_pred EEEEECCCCCHHHHHHHHHHHCCCCEEEEEEECCCCCCEEEEEEEEC----CCCC-HHHHHHHHC Q ss_conf 99998287866889998997369963227742147898189999947----8899-899999864 Q 537021.9.peg.3 26 ICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAISFLCID----GSIL-NSVLEKLSV 85 (100) Q Consensus 26 L~i~~~D~PG~I~~v~~~L~~~~INIa~m~l~r~~~g~~A~~ii~vD----~~i~-~~vl~~i~~ 85 (100) T Consensus 3 iEltg~DRPGLLsei~avLsdl~~~v~~A~iwT~~~-Rva~v~yvtD~~tG~~I~d~~Rla~I~~ 66 (74) T cd04925 3 IELTGTDRPGLLSEVFAVLADLHCNVVEARAWTHNG-RLACVIYVRDEETGAPIDDPIRLASIED 66 (74) T ss_pred EEEECCCCCCHHHHHHHHHHHCCCCEEEEEEEECCC-EEEEEEEEEECCCCCCCCCHHHHHHHHH T ss_conf 887139987269999999986878458878522377-1799999972678996789899999999

HHsearch alignment for GI: peg_33 and conserved domain: cd04925