>pfam01842 ACT ACT domain. This family of domains generally have a regulatory role. ACT domains are linked to a wide range of metabolic enzymes that are regulated by amino acid concentration. Pairs of ACT domains bind specifically to a particular amino acid leading to regulation of the linked enzyme. The ACT domain is found in: D-3-phosphoglycerate dehydrogenase EC:1.1.1.95, which is inhibited by serine. Aspartokinase EC:2.7.2.4, which is regulated by lysine. Acetolactate synthase small regulatory subunit, which is inhibited by valine. Phenylalanine-4-hydroxylase EC:1.14.16.1, which is regulated by phenylalanine. Prephenate dehydrogenase EC:4.2.1.51. formyltetrahydrofolate deformylase EC:3.5.1.10, which is activated by methionine and inhibited by glycine. GTP pyrophosphokinase EC:2.7.6.5.

Probab=98.46 E-value=7.6e-07 Score=56.97 Aligned_cols=65 Identities=22% Similarity=0.228 Sum_probs=55.9 Q ss_pred CEEEEEECCCCCHHHHHHHHHHHCCCCEEEEEEECCCC-CCEEEEEEEECCCCCHHHHHHHHCCCC Q ss_conf 39999982878668899989973699632277421478-981899999478899899999864988 Q 537021.9.peg.3 24 LMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQS-TEHAISFLCIDGSILNSVLEKLSVNVT 88 (100) Q Consensus 24 ~~L~i~~~D~PG~I~~v~~~L~~~~INIa~m~l~r~~~-g~~A~~ii~vD~~i~~~vl~~i~~~~~ 88 (100) T Consensus 1 ~~l~v~~~DrpG~l~~v~~~la~~ginI~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~ 66 (66) T pfam01842 1 TVLEVGVPDRPGLLARVFGALADRGINIESISQSTSGDKAGIVFIVVVVDEEDLEAALEALKKLLG 66 (66) T ss_pred CEEEEEECCCCCHHHHHHHHHHHCCCCEEEEEECCCCCCCCEEEEEEECCHHHHHHHHHHHHHHCC T ss_conf 969997079883799999999877999478997466787625999996675459999999987449

HHsearch alignment for GI: peg_33 and conserved domain: pfam01842