HHsearch alignment of GI: peg_33 and MMDB domain: 2dtj_A_15-94

>2dtj_A (A:15-94) Aspartokinase; protein-ligand complex, regulatory subunit, transferase; HET: CIT; 1.58A {Corynebacterium glutamicum}
Probab=94.90  E-value=0.044  Score=31.51  Aligned_cols=72  Identities=15%  Similarity=-0.046  Sum_probs=45.5

Q ss_pred             EEEEECCCCCHHHHHHHHHHHCCCCEEEEEEE-CCCCCCEEEEEEEECCCCCHHHHHHHHCCCCEEEEEEEEE
Q ss_conf             99998287866889998997369963227742-1478981899999478899899999864988299999997
Q 537021.9.peg.3   26 ICIVNADILGIVVFVGNILGEYGINIAHFHLG-RSQSTEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF   97 (100)
Q Consensus        26 L~i~~~D~PG~I~~v~~~L~~~~INIa~m~l~-r~~~g~~A~~ii~vD~~i~~~vl~~i~~~~~v~~vr~i~~   97 (100)
                      -+.--.|+||+.+++-+.|++++|||.-..-+ +...++..-+-+.+.+.=-+.+++.|.+.-.-.....++.
T Consensus         5 ti~gi~~~pgvaa~iF~~La~~~InVdMI~Q~~s~~~~~~~~isftv~~~d~~~a~~~L~~~~~el~~~~i~~   77 (80)
T 2dtj_A            5 TVLGISDKPGEAAKVFRALADAEINIDMVLQNVSSVEDGTTDITFTCPRSDGRRAMEILKKLQVQGNWTNVLY   77 (80)
T ss_dssp             EEEEEECSTTHHHHHHHHHHHTTCCCCEEEECCCCTTTCEEEEEEEEEHHHHHHHHHHHHTTTTTTTCSEEEE
T ss_pred             EEECCCCCCHHHHHHHHHHHHHCCCHHHHCCCCCCCCCCEEEEECCCCHHHHHHHHHHHCCCCCCCCCCCEEE
T ss_conf             9905899860899999999984436223103332112311255304404566666765201113344321687