HHsearch alignment of GI: peg_33 and MMDB domain: 2re1_A_25-102

>2re1_A (A:25-102) Aspartokinase, alpha and beta subunits; structural genomics, PSI-2, protein structure initiative; 2.75A {Neisseria meningitidis MC58}
Probab=95.44  E-value=0.038  Score=31.84  Aligned_cols=60  Identities=13%  Similarity=0.030  Sum_probs=41.0

Q ss_pred             EEEECCCCCHHHHHHHHHHHCCCCEEEEEEECCCCCCEEEEEEEECCCCCHHHHHHHHCCC
Q ss_conf             9998287866889998997369963227742147898189999947889989999986498
Q 537021.9.peg.3   27 CIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAISFLCIDGSILNSVLEKLSVNV   87 (100)
Q Consensus        27 ~i~~~D~PG~I~~v~~~L~~~~INIa~m~l~r~~~g~~A~~ii~vD~~i~~~vl~~i~~~~   87 (100)
                      +.--.|+||+.+++-+.|+++||||.-..-+ ....+..-+-+.+.+.--+.+++.|.+.-
T Consensus         6 v~gv~~~pGiaa~if~~La~~~InVdmI~Q~-~~~~~~~~isftv~~~d~~~a~~~l~~~~   65 (78)
T 2re1_A            6 VRGVPDKPGVAYQILGAVADANIEVDXIIQN-VGSEGTTDFSFTVPRGDYKQTLEILSERQ   65 (78)
T ss_dssp             EEEEECCTTHHHHHHHHHHTTTCCCCCEEEC-----CEEEEEEEECGGGHHHHHHHHHHSS
T ss_pred             EECCCCCCCHHHHHHHHHHHHCCCHHEEEEE-CCCCCCEEEEEEECCCHHHHHHHHHHHHH
T ss_conf             9158998427899999998837671104662-15688247999841102577888886531